TPRG1 Antibody


Immunocytochemistry/ Immunofluorescence: TPRG1 Antibody [NBP2-49311] - Immunofluorescent staining of human cell line RT4 shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: TPRG1 Antibody [NBP2-49311] - Staining of human tonsil shows moderate cytoplasmic positivity in germinal center cells.

Product Details

Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P

Order Details

TPRG1 Antibody Summary

This antibody was developed against a recombinant protein corresponding to amino acids: TFTEHPMKYTSEKFLEICKLSGFMSKLVPAIQNAHKNSTGSGRGKKLMVLTEPILIETYTG
Specificity of human TPRG1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
TPRG1 Recombinant Protein Antigen (NBP2-49311PEP)

Reactivity Notes

Mouse (85%), Rat (85%)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for TPRG1 Antibody

  • FAM79B
  • FLJ41238
  • FLJ43694
  • member B
  • MGC126599
  • MGC126601
  • Protein FAM79B
  • tumor protein p63 regulated 1
  • tumor protein p63-regulated gene 1 protein


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu
Applications: WB
Species: Hu
Applications: WB, IHC
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF, S-ELISA
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu
Applications: WB, Simple Western, ICC
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for TPRG1 Antibody (NBP2-49311) (0)

There are no publications for TPRG1 Antibody (NBP2-49311).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TPRG1 Antibody (NBP2-49311) (0)

There are no reviews for TPRG1 Antibody (NBP2-49311). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for TPRG1 Antibody (NBP2-49311) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Other Available Formats

Additional TPRG1 Products

Bioinformatics Tool for TPRG1 Antibody (NBP2-49311)

Discover related pathways, diseases and genes to TPRG1 Antibody (NBP2-49311). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TPRG1 Antibody (NBP2-49311)

Discover more about diseases related to TPRG1 Antibody (NBP2-49311).

Blogs on TPRG1

There are no specific blogs for TPRG1, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our TPRG1 Antibody and receive a gift card or discount.


Gene Symbol TPRG1