TPRG1 Antibody

Images

 
Western Blot: TPRG1 Antibody [NBP2-13471] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunocytochemistry/ Immunofluorescence: TPRG1 Antibody [NBP2-13471] - Staining of human cell line U-251 MG shows positivity in nucleoli and nucleus but not nucleoli.
Immunohistochemistry-Paraffin: TPRG1 Antibody [NBP2-13471] - Staining of human stomach, upper shows distinct cytoplasmic and membranous positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TPRG1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: IGSFEGFQAVSLKQEGDDQPSETDHLSMEEEDPMPRQISRQSSVTESTLY PNPYHQPYISRKYFATRPGAIETAMEDLKGHVAE
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TPRG1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
TPRG1 Protein (NBP2-13471PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for TPRG1 Antibody

  • FAM79B
  • FLJ41238
  • FLJ43694
  • member B
  • MGC126599
  • MGC126601
  • Protein FAM79B
  • tumor protein p63 regulated 1
  • tumor protein p63-regulated gene 1 protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56468
Species: Hu, Mu, Rt, Po, Ca
Applications: WB, IHC-P
NBP2-46085
Species: Hu
Applications: WB, IHC
NBP1-87425
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
AF3184
Species: Hu, Mu
Applications: WB, Simple Western, ICC
NBP1-47516
Species: Hu, Mu, Ha, Mk, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P

Publications for TPRG1 Antibody (NBP2-13471) (0)

There are no publications for TPRG1 Antibody (NBP2-13471).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TPRG1 Antibody (NBP2-13471) (0)

There are no reviews for TPRG1 Antibody (NBP2-13471). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for TPRG1 Antibody (NBP2-13471) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TPRG1 Products

Bioinformatics Tool for TPRG1 Antibody (NBP2-13471)

Discover related pathways, diseases and genes to TPRG1 Antibody (NBP2-13471). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TPRG1 Antibody (NBP2-13471)

Discover more about diseases related to TPRG1 Antibody (NBP2-13471).

Blogs on TPRG1

There are no specific blogs for TPRG1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TPRG1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TPRG1