TMEM71 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: TMEM71 Antibody [NBP2-37968] - Staining of human cell line RH-30 shows localization to mitochondria.
Immunohistochemistry: TMEM71 Antibody [NBP2-37968] - Staining of human colon shows moderate cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TMEM71 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: SLTDDWESGKMNAESVITSSSSHIISQPPGGNSHSLSLQSQLTASERFQENSSDHSETRLLQE
Specificity
Specificity of human TMEM71 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TMEM71
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
TMEM71 Protein (NBP2-37968PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for TMEM71 Antibody

  • FLJ33069
  • MGC111188
  • transmembrane protein 71

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-03993
Species: Hu, Bv, Ca, Pm
Applications: WB, IHC, IHC-P
NBP2-61159
Species: Hu
Applications: WB, ELISA, ICC/IF
H00054556-M02
Species: Hu
Applications: WB, ELISA, ICC/IF, IF
NB600-1263
Species: Hu, Mu, Rt
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-P, IP
NBP2-67419
Species: Hu, Mu, Rt
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-P, IP
NBP2-37968
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for TMEM71 Antibody (NBP2-37968) (0)

There are no publications for TMEM71 Antibody (NBP2-37968).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TMEM71 Antibody (NBP2-37968) (0)

There are no reviews for TMEM71 Antibody (NBP2-37968). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for TMEM71 Antibody (NBP2-37968) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for TMEM71 Antibody (NBP2-37968)

Discover related pathways, diseases and genes to TMEM71 Antibody (NBP2-37968). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Pathways for TMEM71 Antibody (NBP2-37968)

View related products by pathway.

PTMs for TMEM71 Antibody (NBP2-37968)

Learn more about PTMs related to TMEM71 Antibody (NBP2-37968).

Blogs on TMEM71

There are no specific blogs for TMEM71, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TMEM71 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TMEM71
Uniprot