TMEM41B Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: TMEM41B Antibody [NBP1-81552] - Staining of human cell line A-431 shows localization to peroxisomes.

Immunohistochemistry-Paraffin: TMEM41B Antibody [NBP1-81552] - Staining of human Skeletal muscle shows no granular cytoplasmic positivity in myocytes as expected.

Immunohistochemistry-Paraffin: TMEM41B Antibody [NBP1-81552] - Staining of human cerebellum shows strong granular cytoplasmic positivity in Purkinje cells.

Immunohistochemistry-Paraffin: TMEM41B Antibody [NBP1-81552] - Staining of human Kidney shows strong granular cytoplasmic positivity in cells in tubules.

Immunohistochemistry-Paraffin: TMEM41B Antibody [NBP1-81552] - Staining of human Testis shows moderate granular cytoplasmic positivity in Leydig cells.

• Reactivity: Hu
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

TMEM41B Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit TMEM41B Antibody - BSA Free (NBP1-81552) is a polyclonal antibody validated for use in IHC and ICC/IF. Anti-TMEM41B Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: MAKGRVAERSQLGAHHTTPVGDGAAGTRGLAAPGSRDHQKEKSWVEAGS
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TMEM41B
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:20-1:50
  • Immunohistochemistry-Paraffin 1:20-1:50
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  TMEM41B Recombinant Protein Antigen (NBP1-81552PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for TMEM41B Antibody - BSA Free

• KIAA0033
• KIAA0033MGC33897
• MGC57262
• Stasimon
• TMEM41B
• transmembrane protein 41B

Background

Transmembrane protein 41B/Stasimon (human TMEM41B theoretical molecular weight 32.5 kDa) is an integral endoplasmic reticulum membrane protein that plays a role in autophagy and neurogenesis (1). TMEM41B forms a complex with vacuole membrane protein 1 (VMP1) and is required for autophagosome formation. Similar to VMP1, TMEM41B contains a VTT domain. Expression of TMEM41B/Stasimon restores motor neuron function defects in Drosophila and zebrafish models of spinal muscular atrophy (SMA). Survival motor neuron protein (SMN) deficiency, which underscores the neuromuscular disorder SMA, affects TMEM41B/Stasimon U12 splicing and mRNA expression (2,3).

1. Stavoe, A. K. H., & Holzbaur, E. L. F. (2019). Autophagy in Neurons. Annual Review of Cell and Developmental Biology. https://doi.org/10.1146/annurev-cellbio-100818-125242

2. Doktor, T. K., Hua, Y., Andersen, H. S., Br0ner, S., Liu, Y. H., Wieckowska, A., Andresen, B. S. (2017). RNA-sequencing of a mouse-model of spinal muscular atrophy reveals tissue-wide changes in splicing of U12-dependent introns. Nucleic Acids Research. https://doi.org/10.1093/nar/gkw731

3. Hosseinibarkooie, S., Schneider, S., & Wirth, B. (2017). Advances in understanding the role of disease-associated proteins in spinal muscular atrophy. Expert Review of Proteomics. https://doi.org/10.1080/14789450.2017.1345631

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for TMEM41B Antibody (NBP1-81552)(1)

Publication using NBP1-81552

• Ye Zhu, Motoki Fujimaki, Louisa Snape, Ana Lopez, Angeleen Fleming, David C. Rubinsztein Loss of WIPI4 in neurodegeneration causes autophagy-independent ferroptosis Nature Cell Biology 2024-03-07 [PMID: 38454050]

Bioinformatics

• Gene Symbol: TMEM41B