TMEM41B Antibody - BSA Free Summary
| Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids: MAKGRVAERSQLGAHHTTPVGDGAAGTRGLAAPGSRDHQKEKSWVEAGS |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
TMEM41B |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
- Immunohistochemistry 1:20-1:50
- Immunohistochemistry-Paraffin 1:20-1:50
|
| Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
| Control Peptide |
|
| Publications |
|
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for TMEM41B Antibody - BSA Free
Background
Transmembrane protein 41B/Stasimon (human TMEM41B theoretical molecular weight 32.5 kDa) is an integral endoplasmic reticulum membrane protein that plays a role in autophagy and neurogenesis (1). TMEM41B forms a complex with vacuole membrane protein 1 (VMP1) and is required for autophagosome formation. Similar to VMP1, TMEM41B contains a VTT domain. Expression of TMEM41B/Stasimon restores motor neuron function defects in Drosophila and zebrafish models of spinal muscular atrophy (SMA). Survival motor neuron protein (SMN) deficiency, which underscores the neuromuscular disorder SMA, affects TMEM41B/Stasimon U12 splicing and mRNA expression (2,3).
1. Stavoe, A. K. H., & Holzbaur, E. L. F. (2019). Autophagy in Neurons. Annual Review of Cell and Developmental Biology. https://doi.org/10.1146/annurev-cellbio-100818-125242
2. Doktor, T. K., Hua, Y., Andersen, H. S., Br0ner, S., Liu, Y. H., Wieckowska, A., Andresen, B. S. (2017). RNA-sequencing of a mouse-model of spinal muscular atrophy reveals tissue-wide changes in splicing of U12-dependent introns. Nucleic Acids Research. https://doi.org/10.1093/nar/gkw731
3. Hosseinibarkooie, S., Schneider, S., & Wirth, B. (2017). Advances in understanding the role of disease-associated proteins in spinal muscular atrophy. Expert Review of Proteomics. https://doi.org/10.1080/14789450.2017.1345631
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Pm, Rt, Xp, Ze
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, KD, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, KO, WB
Publications for TMEM41B Antibody (NBP1-81552)(1)
Showing Publication 1 -
1 of 1.
Reviews for TMEM41B Antibody (NBP1-81552) (0)
There are no reviews for TMEM41B Antibody (NBP1-81552).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for TMEM41B Antibody (NBP1-81552) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional TMEM41B Products
Research Areas for TMEM41B Antibody (NBP1-81552)
Find related products by research area.
|
Blogs on TMEM41B