![Western Blot: TMEM159 Antibody [NBP1-80877] - Analysis in control (vector only transfected HEK293T lysate) and TMEM159 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).](http://images.novusbio.com/fullsize/TMEM159-Antibody-Western-Blot-NBP1-80877-img0004.jpg "Western Blot: TMEM159 Antibody [NBP1-80877] - Analysis in control (vector only transfected HEK293T lysate) and TMEM159 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).")
| Reactivity | HuSpecies Glossary |
| Applications | WB, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Description | Novus Biologicals Rabbit TMEM159 Antibody - BSA Free (NBP1-80877) is a polyclonal antibody validated for use in IHC and WB. Anti-TMEM159 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: MAKEEPQSISRDLQELQKKLSLLIDSFQNNSKVVAFMKSPVGQY |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | TMEM159 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
| Publications using NBP1-80877 | Applications | Species |
|---|---|---|
| William K, Peter L, Michael GH et al The Sar1 GTPase Is Dispensable for COPII-Dependent Cargo Export From the ER SSRN Electronic Journal 2022-11-20 | ||
| Kumar R, Mehta D, Chaudhary S Et al. Impact of CHIKV Replication on the Global Proteome of Aedes albopictus Cells Proteomes 2022-11-22 [PMID: 36412637] (WB) Details: Citation using the HRP version of this antibody. |
WB |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunohistochemistry-Paraffin: TMEM159 Antibody [NBP1-80877] - Staining of human cerebral cortex shows very weak cytoplasmic positivity in neurons.](http://images.novusbio.com/fullsize/TMEM159-Antibody-Immunohistochemistry-Paraffin-NBP1-80877-img0008.jpg "Immunohistochemistry-Paraffin: TMEM159 Antibody [NBP1-80877] - Staining of human cerebral cortex shows very weak cytoplasmic positivity in neurons.")
![Immunohistochemistry-Paraffin: TMEM159 Antibody [NBP1-80877] - Staining of human skeletal muscle shows moderate granular cytoplasmic positivity in myocytes.](http://images.novusbio.com/fullsize/TMEM159-Antibody-Immunohistochemistry-Paraffin-NBP1-80877-img0005.jpg "Immunohistochemistry-Paraffin: TMEM159 Antibody [NBP1-80877] - Staining of human skeletal muscle shows moderate granular cytoplasmic positivity in myocytes.")
![Immunohistochemistry-Paraffin: TMEM159 Antibody [NBP1-80877] - Staining of human heart muscle shows moderate granular cytoplasmic positivity in cardiomyoctes.](http://images.novusbio.com/fullsize/TMEM159-Antibody-Immunohistochemistry-Paraffin-NBP1-80877-img0006.jpg "Immunohistochemistry-Paraffin: TMEM159 Antibody [NBP1-80877] - Staining of human heart muscle shows moderate granular cytoplasmic positivity in cardiomyoctes.")
![Immunohistochemistry-Paraffin: TMEM159 Antibody [NBP1-80877] - Staining of human kidney shows moderate granular ctyoplasmic positivity in cells in tubules.](http://images.novusbio.com/fullsize/TMEM159-Antibody-Immunohistochemistry-Paraffin-NBP1-80877-img0007.jpg "Immunohistochemistry-Paraffin: TMEM159 Antibody [NBP1-80877] - Staining of human kidney shows moderate granular ctyoplasmic positivity in cells in tubules.")
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")