We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

TCTN1 Recombinant Protein Antigen

Images

 
There are currently no images for TCTN1 Protein (NBP1-83624PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

TCTN1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human TCTN1.

Source: E. coli

Amino Acid Sequence: VPLSGNPGYVVGLPLAAGFQPHKGSGIIQTTNRYGQLTILHSTTEQDCLALEGVRTPVLFGYTMQSGCKLRLTGALPCQLVAQ

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
TCTN1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-83624.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for TCTN1 Recombinant Protein Antigen

  • JBTS13
  • TCTN1
  • TECT1
  • TECT1FLJ21127
  • tectonic 1
  • tectonic family member 1
  • Tectonic-1

Background

TCTN1 encodes a member of the tectonic family of secreted and transmembrane proteins. The orthologous gene in mouse is required for formation of most ventral cell types. It functions downstream of smoothened and rab23 to modulate hedgehog signal transduction. Multiple transcript variants encoding different isoforms have been found for this gene. Transcript Variant: This variant (3) uses an alternate exon combination in the central coding region and an alternate in-frame splice site in the 3' coding region, compared to variant 1, resulting in a shorter protein (isoform 3).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-86991
Species: Hu, Mu
Applications: ICC/IF, IP, WB
NBP1-88392
Species: Hu
Applications: ICC/IF,  IHC-P, WB
NBP2-32673
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP1-77183
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBL1-17065
Species: Hu
Applications: WB
NBP2-15463
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-92683
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
NBP2-92821
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NLS2666
Species: Bt, Bv, Ca, Eq, Ha, Hu, Pm, Mu, Po, Rb, Rt
Applications: ICC/IF, IHC,  IHC-P
AF3690
Species: Hu, Mu
Applications: ChIP, ICC, WB
NBP1-88691
Species: Hu
Applications: IHC,  IHC-P, WB
NBP1-06590
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, WB
NBP2-02984
Species: Ca, Hu, Pm, Mu, Pm, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP1-78206
Species: Hu
Applications: IP, WB
NBP2-33656
Species: Hu
Applications: IHC,  IHC-P, WB
NBP3-46689
Species: Hu
Applications: ELISA, IHC, IP, WB
NBP1-51975
Species: Hu
Applications: PEP-ELISA, WB
NBP3-47705
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, WB
NBP1-83624PEP
Species: Hu
Applications: AC

Publications for TCTN1 Protein (NBP1-83624PEP) (0)

There are no publications for TCTN1 Protein (NBP1-83624PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TCTN1 Protein (NBP1-83624PEP) (0)

There are no reviews for TCTN1 Protein (NBP1-83624PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for TCTN1 Protein (NBP1-83624PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional TCTN1 Products

Research Areas for TCTN1 Protein (NBP1-83624PEP)

Find related products by research area.

Blogs on TCTN1

There are no specific blogs for TCTN1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our TCTN1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol TCTN1