TBC1D13 Antibody

Images

 
Western Blot: TBC1D13 Antibody [NBP1-92477] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunocytochemistry/ Immunofluorescence: TBC1D13 Antibody [NBP1-92477] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoli.
Immunohistochemistry-Paraffin: TBC1D13 Antibody [NBP1-92477] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.
Western Blot: TBC1D13 Antibody [NBP1-92477] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). ...read more

Product Details

Summary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TBC1D13 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: EDHPLNPNPDSRWNTYFKDNEVLLQIDKDVRRLCPDISFFQRATDYPCLLILDPQNEFETLRKRVEQTTLKSQTVAR
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TBC1D13
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
TBC1D13 Protein (NBP1-92477PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for TBC1D13 Antibody

  • FLJ10743
  • TBC1 domain family member 13
  • TBC1 domain family, member 13

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-49533
Species: Hu, Mu, Rt, Pl
Applications: WB, Flow, ICC/IF, IHC, IHC-P, Flow-IC, KD
NBP1-51634
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF
NBP2-04611
Species: Hu
NBP2-20042
Species: Hu, Mu, Ha
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-54654
Species: Hu
Applications: WB, IHC, IHC-P

Publications for TBC1D13 Antibody (NBP1-92477) (0)

There are no publications for TBC1D13 Antibody (NBP1-92477).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TBC1D13 Antibody (NBP1-92477) (0)

There are no reviews for TBC1D13 Antibody (NBP1-92477). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for TBC1D13 Antibody (NBP1-92477) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional TBC1D13 Products

Bioinformatics Tool for TBC1D13 Antibody (NBP1-92477)

Discover related pathways, diseases and genes to TBC1D13 Antibody (NBP1-92477). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Pathways for TBC1D13 Antibody (NBP1-92477)

View related products by pathway.

Blogs on TBC1D13

There are no specific blogs for TBC1D13, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TBC1D13 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TBC1D13