TAF1D Antibody

Images

 
Immunohistochemistry-Paraffin: TAF1D Antibody [NBP2-31821] - Staining of human breast shows strong cytoplasmic and membranous positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TAF1D Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: YQPTGRPRGRPEGRRNPIYSLIDKKKQFRSRGSGFPFLESENEKNAPWRKILTFEQAVARGFFNYIEKLKYEHHL
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TAF1D
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
TAF1D Protein (NBP2-31821PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for TAF1D Antibody

  • JOSD3RNA polymerase I-specific TBP-associated factor 41 kDa
  • Josephin domain containing 3
  • MGC5306
  • RAFI41
  • TAF(I)41
  • TAFI41
  • TATA box binding protein (TBP)-associated factor, RNA polymerase I, D, 41kDa
  • TATA box-binding protein-associated factor 1D
  • TATA box-binding protein-associated factor RNA polymerase I subunit D
  • TBP-associated factor 1D
  • Transcription initiation factor SL1/TIF-IB subunit D

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-12933
Species: Hu, Mu, Rt, Po
Applications: WB, PEP-ELISA
H00009014-B01P
Species: Hu
Applications: WB, ICC/IF
NBP2-47609
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-12779
Species: Hu
Applications: WB, IP
NBP1-77847
Species: Hu, Mu, Rt
Applications: WB, ChIP, ELISA, IHC, IHC-P, IP
NBP1-80705
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00006879-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, RNAi
NBP2-55698
Species: Hu
Applications: ICC/IF
AF1334
Species: Hu
Applications: WB, IHC
NBP2-38188
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for TAF1D Antibody (NBP2-31821) (0)

There are no publications for TAF1D Antibody (NBP2-31821).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TAF1D Antibody (NBP2-31821) (0)

There are no reviews for TAF1D Antibody (NBP2-31821). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for TAF1D Antibody (NBP2-31821) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TAF1D Products

Bioinformatics Tool for TAF1D Antibody (NBP2-31821)

Discover related pathways, diseases and genes to TAF1D Antibody (NBP2-31821). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Pathways for TAF1D Antibody (NBP2-31821)

View related products by pathway.

PTMs for TAF1D Antibody (NBP2-31821)

Learn more about PTMs related to TAF1D Antibody (NBP2-31821).

Blogs on TAF1D

There are no specific blogs for TAF1D, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TAF1D Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TAF1D
Uniprot