SYCP2L Antibody

Images

 
Western Blot: SYCP2L Antibody [NBP1-91163] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-561
Immunocytochemistry/ Immunofluorescence: SYCP2L Antibody [NBP1-91163] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: SYCP2L Antibody [NBP1-91163] - Staining of human cerebral cortex shows distinct cytoplasmic and nuclear positivity in neuronal cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SYCP2L Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:TSMICVIEDFFDTALIISRSSSEGKIQMLDSFLLSLGFLVTEKTVNHLLQQEGLKTFNCILHAVPREERKKFPLSEGMCHLMKDLARTLLTVGDYDQQV
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SYCP2L
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
SYCP2L Protein (NBP1-91163PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SYCP2L Antibody

  • dJ62D2.1
  • synaptonemal complex protein 2-like

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-85958
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-55940
Species: Hu
Applications: ICC/IF
NBP1-87156
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-325
Species: Hu
Applications: WB, ChIP, IP
NBP1-32283
Species: Hu, Mu, Rt
Applications: WB
H00004810-M05
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-38799
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-76778
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-81743
Species: Hu
Applications: WB, IHC, IHC-P
AF7726
Species: Hu
Applications: WB, IHC

Publications for SYCP2L Antibody (NBP1-91163) (0)

There are no publications for SYCP2L Antibody (NBP1-91163).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SYCP2L Antibody (NBP1-91163) (0)

There are no reviews for SYCP2L Antibody (NBP1-91163). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for SYCP2L Antibody (NBP1-91163) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SYCP2L Products

SYCP2L NBP1-91163

Bioinformatics Tool for SYCP2L Antibody (NBP1-91163)

Discover related pathways, diseases and genes to SYCP2L Antibody (NBP1-91163). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SYCP2L Antibody (NBP1-91163)

Discover more about diseases related to SYCP2L Antibody (NBP1-91163).
 

Pathways for SYCP2L Antibody (NBP1-91163)

View related products by pathway.

Blogs on SYCP2L

There are no specific blogs for SYCP2L, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SYCP2L Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SYCP2L