Recombinant Human Suppressor of Ty 4 homolog 1 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human Suppressor of Ty 4 homolog 1 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-117 of Human SUPT4H1 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MALETVPKDLRHLRACLLCSLVKTIDQFEYDGCDNCDAYLQMKGNREMVYDCTSSSFDGIIAMMSPEDSWVSKWQRVSNFKPGVYAVSVTGRLPQGIVRELKSRGVAYKSRDTAIKT

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
SUPT4H1

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Suppressor of Ty 4 homolog 1 Protein

  • DRB sensitivity-inducing factor 14 kDa subunit
  • DRB sensitivity-inducing factor small subunit
  • DSIF p14
  • DSIF small subunit
  • SPT4
  • SPT4HhSPT4
  • suppressor of Ty (S.cerevisiae) 4 homolog 1
  • suppressor of Ty 4 homolog 1 (S. cerevisiae)
  • SUPT4H
  • transcription elongation factor SPT4

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-83508
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-2582
Species: Hu, Mu, Ch
Applications: WB, ChIP, IHC, IHC-P, IP
NB120-10874
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP1-92175
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-61070
Species: Hu
Applications: WB (-), IP
NB200-598
Species: Hu, Mu, Ye, Pm(-)
Applications: WB, ChIP, ELISA, Flow, ICC/IF, IP, CyTOF-ready, Flow-IC
H00006919-B02P
Species: Hu
Applications: WB, ICC/IF
NBP1-93707
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00006920-M08
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP1-87351
Species: Hu
Applications: IHC, IHC-P
NB600-273
Species: Hu, Mu, Rt
Applications: WB
NBP2-38607
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-30955
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-82454
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89200
Species: Hu, Mu
Applications: WB, Simple Western, IHC, IHC-P
NBP2-49349
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB500-171
Species: Hu, Mu, Rt, Xp, Ye
Applications: WB, ChIP, ICC/IF, IHC, IHC-P
NB100-558
Species: Hu
Applications: WB, ChIP, IHC, IHC-P, IP

Publications for Suppressor of Ty 4 homolog 1 Recombinant Protein (H00006827-P01) (0)

There are no publications for Suppressor of Ty 4 homolog 1 Recombinant Protein (H00006827-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Suppressor of Ty 4 homolog 1 Recombinant Protein (H00006827-P01) (0)

There are no reviews for Suppressor of Ty 4 homolog 1 Recombinant Protein (H00006827-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Suppressor of Ty 4 homolog 1 Recombinant Protein (H00006827-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Suppressor of Ty 4 homolog 1 Products

Bioinformatics Tool for Suppressor of Ty 4 homolog 1 Recombinant Protein (H00006827-P01)

Discover related pathways, diseases and genes to Suppressor of Ty 4 homolog 1 Recombinant Protein (H00006827-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Suppressor of Ty 4 homolog 1 Recombinant Protein (H00006827-P01)

Discover more about diseases related to Suppressor of Ty 4 homolog 1 Recombinant Protein (H00006827-P01).
 

Pathways for Suppressor of Ty 4 homolog 1 Recombinant Protein (H00006827-P01)

View related products by pathway.

PTMs for Suppressor of Ty 4 homolog 1 Recombinant Protein (H00006827-P01)

Learn more about PTMs related to Suppressor of Ty 4 homolog 1 Recombinant Protein (H00006827-P01).

Blogs on Suppressor of Ty 4 homolog 1

There are no specific blogs for Suppressor of Ty 4 homolog 1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Suppressor of Ty 4 homolog 1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol SUPT4H1