ST6 Sialyltransferase 6/ST6GALNAC6 Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

ST6 Sialyltransferase 6/ST6GALNAC6 Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ST6 Sialyltransferase 6/ST6GALNAC6
  
  

  Source: E.coli

  Amino Acid Sequence: SSNSANEVFHYGSLRGRSRRPVNLKKWSITDGYVPILGNKTLP

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: ST6GALNAC6
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10-100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-25158It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for ST6 Sialyltransferase 6/ST6GALNAC6 Recombinant Protein Antigen

• alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 6
• CMP-NeuAC:(beta)-N-acetylgalactosaminide (alpha)2,6-sialyltransferase member VI
• EC 2.4.99
• EC 2.4.99.-
• EC 2.4.99.7
• GalNAc alpha-2,6-sialyltransferase VI
• hST6GalNAc VI
• RP11-203J24.3
• Sialyltransferase 7F
• sialytransferase 7 ((alpha-N-acetylneuraminyl 2,3-betagalactosyl-1,3)-N-acetylgalactosaminide alpha-2,6-sialytransferase) F
• SIAT7F
• SIAT7-F
• ST6 (alpha-N-acetyl-neuraminyl-2,3-beta-galactosyl-1,3)-N-acetylgalactosaminidealpha-2,6-sialyltransferase 6
• ST6GalNAc VI
• ST6GALNAC6
• ST6GALNACVI

Background

Alpha-2,6-sialyltransferase involved in the synthesis of alpha-series gangliosides. Has activity toward GD1a, GT1b and GM1b. Has no activity toward glycoproteins. Responsible for the biosynthesis of DSGG (disialylgalactosylgloboside) from MSGG (monosialylgalactosylgloboside) in normal and malignant kidney. Participates in the synthesis of disialyl Lewis a (Le(a)), a representative tumor-associated antigen in cancers of the pancreas and colon, in colon tissues

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ST6GALNAC6