ST3 beta-Gal alpha-2,3-Sialyltransferase 2/ST3GAL2 Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

ST3 beta-Gal alpha-2,3-Sialyltransferase 2/ST3GAL2 Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ST3GAL2.
  
  

  Source: E. coli

  Amino Acid Sequence: ATLPYLDSGALDGTHRVKLVPGYAGLQRLSKERLSGKSCACRRCMGDAGASDWFDSHFDGNISPVWTRENMDLPPDVQRWWMMLQPQFKSHNTNEVLEKLFQIVPGENPYRFRDPHQCRRCAVVGNSGNLRGSGYGQDVD

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

  This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

• Source: E. coli
• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: ST3GAL2
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10 - 100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-87044.

  It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

  For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

• Theoretical MW: 33 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for ST3 beta-Gal alpha-2,3-Sialyltransferase 2/ST3GAL2 Recombinant Protein Antigen

• Alpha 2,3-ST 2
• Beta-galactoside alpha-2,3-sialyltransferase 2
• beta-galactoside alpha-2,3-sialytransferase
• CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 2
• EC 2.4.99.4
• EC 2.4.99.7
• Gal-beta-1,3-GalNAc-alpha-2,3-sialyltransferase
• Gal-NAc6S
• sialyltransferase 4B (beta-galactosidase alpha-2,3-sialytransferase)
• Sialyltransferase 4B
• SIAT4B
• SIAT4-B
• ST3 beta-galactoside alpha-2,3-sialyltransferase 2
• ST3GAL2
• ST3GalA.2
• ST3GalA.2ST3Gal II
• ST3GALII

Background

ST3GAL2 is encoded by this gene is a type II membrane protein that catalyzes the transfer of sialic acid from CMP-sialic acid to galactose-containing substrates. The encoded protein is normally found in the Golgi but can be proteolytically processed to a soluble form. This protein, which is a member of glycosyltransferase family 29, can use the same acceptor substrates as does sialyltransferase 4A.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Bioinformatics

• Gene Symbol: ST3GAL2