Sperm Flagellar 2 Antibody - BSA Free

Immunohistochemistry-Paraffin: Sperm Flagellar 2 Antibody [NBP1-84361] - Staining of human liver shows no positivity in hepatocytes as expected.

Immunohistochemistry-Paraffin: Sperm Flagellar 2 Antibody [NBP1-84361] - Analysis in human fallopian tube and skeletal muscle tissues. Corresponding Sperm Flagellar 2 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: Sperm Flagellar 2 Antibody [NBP1-84361] - Staining of human fallopian tube, liver, pancreas and skeletal muscle using Anti-Sperm Flagellar 2 antibody NBP1-84361 (A) shows similar protein distribution across tissues to independent antibody NBP2-38461 (B).

Immunohistochemistry-Paraffin: Sperm Flagellar 2 Antibody [NBP1-84361] - Staining of human fallopian tube shows strong cytoplasmic positivity in cilia in glandular cells.

Staining of human pancreas shows no positivity in exocrine glandular cells as expected.

Staining of human skeletal muscle shows no positivity in myocytes as expected.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Sperm Flagellar 2 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: VPQPPKPGSEEWVYVNEPVPEEMPLFLVPYWELIENSYINTIKTVLRHLREDQHTVLAYLYEIRTSFQEFLKRPDHKQDFVAQWQ
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SPEF2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  Sperm Flagellar 2 Protein (NBP1-84361PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (82%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Sperm Flagellar 2 Antibody - BSA Free

• cancer/testis antigen 122
• CT122
• FLJ23164
• FLJ23577
• FLJ25395
• KIAA1770
• KPL2MGC102842
• Protein KPL2
• sperm flagellar 2
• sperm flagellar protein 2

Background

The SPEF2 gene encodes a sperm flagellar protein 2 that exists in four isoforms. Isoform 1 is 1,822 amino acids long at 209 kDA, isoform 2 is 1,818 amino acids long at 209 kDA, isoform 3 is 514 amino acids long at 61 kDA, and isoform 4 is 619 amino acids long at 70 kDA. The protein encoded by the SPEF2 gene is thought to be critical to correct axoneme development. This gene interacts with genes APOA1 and IGHA1. SPEF2 has been linked to diseases such as primary ciliary dyskinesia and infertility.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SPEF2