Sperm Flagellar 2 Antibody

Images

 
Immunohistochemistry-Paraffin: Sperm Flagellar 2 Antibody [NBP1-84361] - Staining of human fallopian tube shows strong positivity in cilia of glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Sperm Flagellar 2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:VPQPPKPGSEEWVYVNEPVPEEMPLFLVPYWELIENSYINTIKTVLRHLREDQHTVLAYLYEIRTSFQEFLKRPDHKQDFVAQWQ
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SPEF2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Sperm Flagellar 2 Protein (NBP1-84361PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (82%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Sperm Flagellar 2 Antibody

  • cancer/testis antigen 122
  • CT122
  • FLJ23164
  • FLJ23577
  • FLJ25395
  • KIAA1770
  • KPL2MGC102842
  • Protein KPL2
  • sperm flagellar 2
  • sperm flagellar protein 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB300-561
Species: Hu, Mu, Rt, Po, Bv, Eq, Ha, Rb, Sh
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, ICC, IF
NBP1-88582
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-33838
Species: Hu
Applications: IHC, IHC-P
NBP1-86424
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-14707
Species: Hu
Applications: IHC, IHC-P
NBP1-87088
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84361
Species: Hu
Applications: IHC, IHC-P

Publications for Sperm Flagellar 2 Antibody (NBP1-84361) (0)

There are no publications for Sperm Flagellar 2 Antibody (NBP1-84361).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Sperm Flagellar 2 Antibody (NBP1-84361) (0)

There are no reviews for Sperm Flagellar 2 Antibody (NBP1-84361). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Sperm Flagellar 2 Antibody (NBP1-84361) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Sperm Flagellar 2 Products

Bioinformatics Tool for Sperm Flagellar 2 Antibody (NBP1-84361)

Discover related pathways, diseases and genes to Sperm Flagellar 2 Antibody (NBP1-84361). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Sperm Flagellar 2 Antibody (NBP1-84361)

Discover more about diseases related to Sperm Flagellar 2 Antibody (NBP1-84361).
 

Pathways for Sperm Flagellar 2 Antibody (NBP1-84361)

View related products by pathway.

Blogs on Sperm Flagellar 2

There are no specific blogs for Sperm Flagellar 2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Sperm Flagellar 2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SPEF2