SPEF1 Antibody

Images

 
Immunohistochemistry-Paraffin: SPEF1 Antibody [NBP2-14707] - Staining of human fallopian tube shows high expression.
Immunohistochemistry-Paraffin: SPEF1 Antibody [NBP2-14707] - Staining of human colon shows low expression as expected.
Orthogonal Strategies: Immunohistochemistry-Paraffin: SPEF1 Antibody [NBP2-14707] - Staining in human fallopian tube and colon tissues using anti-SPEF1 antibody. Corresponding SPEF1 RNA-seq data are presented for ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

SPEF1 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the amino acids: RDFSDGVLVAEVIKFYFPKMVEMHNYVPANSLQQKLSNWGHLNRKVLKRLNFSVPDDVMRKIAQCAPGVVELVLIPLRQRLEERQRRRKQGAGSLQELAPQDGSGYMDVGKVAFSISPSRL
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SPEF1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
SPEF1 Protein (NBP2-14707PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (83%), Rat (83%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SPEF1 Antibody

  • C20orf28
  • CLAMP
  • SPEF1 sperm flagellar 1
  • SPEF1A

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-84361
Species: Hu
Applications: IHC, IHC-P
NBP2-14707
Species: Hu
Applications: IHC

Publications for SPEF1 Antibody (NBP2-14707) (0)

There are no publications for SPEF1 Antibody (NBP2-14707).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SPEF1 Antibody (NBP2-14707) (0)

There are no reviews for SPEF1 Antibody (NBP2-14707). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for SPEF1 Antibody (NBP2-14707) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SPEF1 Products

Array NBP2-14707

Pathways for SPEF1 Antibody (NBP2-14707)

View related products by pathway.

Blogs on SPEF1

There are no specific blogs for SPEF1, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SPEF1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SPEF1