Recombinant Human SPATA7 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human SPATA7 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-567 of Human SPATA7 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MDGSRRVRATSVLPRYGPPCLFKGHLSTKSNAAVDCSVPVSVSTSIKYADQQRREKLKKELAQCEKEFKLTKTAMRANYKNNSKSLFNTLQKPSGEPQIEDDMLKEEMNGFSSFARSLVPSSERLHLSLHKSSKVITNGPEKNSSSSPSSVDYAASGPRKLSSGALYGRRPRSTFPNSHRFQLVISKAPSGDLLDKHSELFSNKQLPFTPRTLKTEAKSFLSQYRYYTPAKRKKDFTDQRIEAETQTELSFKSELGTAETKNMTDSEMNIKQASNCVTYDAKEKIAPLPLEGHDSTWDEIKDDALQHSSPRAMCQYSLKPPSTRKIYSDEEELLYLSFIEDVTDEILKLGLFSNRFLERLFERHIKQNKHLEEEKMRHLLHVLKVDLGCTSEENSVKQNDVDMLNVFDFEKAGNSEPNELKNESEVTIQQERQQYQKALDMLLSAPKDENEIFPSPTEFFMPIYKSKHSEGVIIQQVNDETNLETSTLDENHPSISDSLTDRETSVNVIEGDSDPEKVEISNGLCGLNTSPSQSVQFSSVKGDNNHDMELSTLKIMEMSIEDCPLDV

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
SPATA7
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human SPATA7 Protein

  • HSD-3.1
  • HSD3DKFZp686D07199
  • LCA3
  • Leber congenital amaurosis 3
  • MGC102934
  • spermatogenesis associated 7
  • spermatogenesis-associated protein 7
  • Spermatogenesis-associated protein HSD3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-56113
Species: Hu
Applications: IHC-P
H00003000-M06
Species: Hu
Applications: WB, ELISA, ICC/IF
NB100-355
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Xp
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready
NBP1-86759
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
H00001406-M02
Species: Hu, Mu
Applications: WB, ChIP, ELISA, ICC/IF
NBP1-46510
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-01327
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-13249
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00145226-D01P
Species: Hu
Applications: WB, ELISA
NB100-86991
Species: Hu, Mu
Applications: WB, ICC/IF, IP
NBP1-31401
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB8630
Species: Hu
Applications: WB, IHC
NB100-77417
Species: Mu
Applications: WB, Flow, Func, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vivo, CyTOF-ready
NBP1-84168
Species: Hu
Applications: IHC, IHC-P
NBP1-85729
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
MAB7450
Species: Hu
Applications: IHC

Publications for SPATA7 Recombinant Protein (H00055812-P01) (0)

There are no publications for SPATA7 Recombinant Protein (H00055812-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SPATA7 Recombinant Protein (H00055812-P01) (0)

There are no reviews for SPATA7 Recombinant Protein (H00055812-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SPATA7 Recombinant Protein (H00055812-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional SPATA7 Products

Bioinformatics Tool for SPATA7 Recombinant Protein (H00055812-P01)

Discover related pathways, diseases and genes to SPATA7 Recombinant Protein (H00055812-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SPATA7 Recombinant Protein (H00055812-P01)

Discover more about diseases related to SPATA7 Recombinant Protein (H00055812-P01).
 

Pathways for SPATA7 Recombinant Protein (H00055812-P01)

View related products by pathway.

PTMs for SPATA7 Recombinant Protein (H00055812-P01)

Learn more about PTMs related to SPATA7 Recombinant Protein (H00055812-P01).

Blogs on SPATA7

There are no specific blogs for SPATA7, but you can read our latest blog posts.

Customers Who Bought This Also Bought

SPATA7 Antibody
NBP1-83195

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human SPATA7 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol SPATA7