SPATA16 Antibody

Images

 
Western Blot: SPATA16 Antibody [NBP2-13368] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4
Immunohistochemistry-Paraffin: SPATA16 Antibody [NBP2-13368] - Staining of human testis shows strong nuclear positivity in subset of cells in seminiferus ducts.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SPATA16 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: LQALHMLPQTVDWSSFPPQQYLLTLGFKNKDDGKFLEKISSRKLPIFTEH KTPFGLTREDTVRQMETMGKRIL
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SPATA16
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
SPATA16 Protein (NBP2-13368PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (82%), Rat (80%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SPATA16 Antibody

  • NYD-SP12
  • spermatogenesis associated 16
  • Testis development protein NYD-SP12
  • testis-specific Golgi protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-56009
Species: Hu
Applications: WB, ICC/IF
NBP1-85632
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-85630
Species: Hu
Applications: WB, IHC, IHC-P
NB120-3420
Species: Mu, Rt
Applications: WB, ICC/IF, IP, ICC, IF
NBP2-33887
Species: Hu
Applications: IHC, IHC-P
NBP1-84168
Species: Hu
Applications: IHC, IHC-P
NBP1-77242
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P, IF
NB100-379
Species: Hu, Mu
Applications: WB, IP
NBP1-33169
Species: Hu, Mu
Applications: WB
NBP1-89929
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-91991
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
MAB2005
Species: Hu
Applications: WB, Flow, CyTOF-ready
NB100-534
Species: Hu
Applications: WB, IP
NBP2-13368
Species: Hu
Applications: WB, IHC, IHC-P

Publications for SPATA16 Antibody (NBP2-13368) (0)

There are no publications for SPATA16 Antibody (NBP2-13368).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SPATA16 Antibody (NBP2-13368) (0)

There are no reviews for SPATA16 Antibody (NBP2-13368). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SPATA16 Antibody (NBP2-13368) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SPATA16 Products

Bioinformatics Tool for SPATA16 Antibody (NBP2-13368)

Discover related pathways, diseases and genes to SPATA16 Antibody (NBP2-13368). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SPATA16 Antibody (NBP2-13368)

Discover more about diseases related to SPATA16 Antibody (NBP2-13368).
 

Pathways for SPATA16 Antibody (NBP2-13368)

View related products by pathway.

PTMs for SPATA16 Antibody (NBP2-13368)

Learn more about PTMs related to SPATA16 Antibody (NBP2-13368).

Blogs on SPATA16

There are no specific blogs for SPATA16, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SPATA16 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SPATA16