DPY19L2 Antibody

Images

 
Western Blot: DPY19L2 Antibody [NBP2-56009] - Western blot analysis in human cell line RT-4, human cell line U-251 MG, human plasma and human liver tissue.
Immunocytochemistry/ Immunofluorescence: DPY19L2 Antibody [NBP2-56009] - Staining of human cell line A549 shows localization to mitochondria.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

DPY19L2 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: KQGVSSKRLQSSGCSQSKGRRGASLAREPEVEEEM
Specificity
Specificity of human DPY19L2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
DPY19L2
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
DPY19L2 Recombinant Protein Antigen (NBP2-56009PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for DPY19L2 Antibody

  • dpy-19-like 2 (C. elegans)
  • Dpy-19-like protein 2
  • FLJ32949
  • FLJ36166
  • protein dpy-19 homolog 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-13368
Species: Hu
Applications: WB, IHC, IHC-P
NB100-41403
Species: Hu, Mu, Rt
Applications: WB, IHC-P, PEP-ELISA
NBP2-52532
Species: Hu, Rt, Mk
Applications: WB, ELISA, Flow, IHC, IHC-P, CyTOF-ready, ICC, IF
MAB25031
Species: Hu
Applications: WB, IHC, IP
NBP1-86489
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00554236-P01
Species: Hu
MAB2005
Species: Hu
Applications: WB, Flow, CyTOF-ready
H00089869-R01
Species: Hu
NBP2-39041
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-56009
Species: Hu
Applications: WB, ICC/IF

Publications for DPY19L2 Antibody (NBP2-56009) (0)

There are no publications for DPY19L2 Antibody (NBP2-56009).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DPY19L2 Antibody (NBP2-56009) (0)

There are no reviews for DPY19L2 Antibody (NBP2-56009). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for DPY19L2 Antibody (NBP2-56009) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for DPY19L2 Antibody (NBP2-56009)

Discover related pathways, diseases and genes to DPY19L2 Antibody (NBP2-56009). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DPY19L2 Antibody (NBP2-56009)

Discover more about diseases related to DPY19L2 Antibody (NBP2-56009).
 

Pathways for DPY19L2 Antibody (NBP2-56009)

View related products by pathway.

Blogs on DPY19L2

There are no specific blogs for DPY19L2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our DPY19L2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol DPY19L2