Soggy-1/DkkL1 Antibody - BSA Free Summary
| Description |
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution. |
| Immunogen |
Synthetic peptides corresponding to DKKL1(dickkopf-like 1 (soggy)) The peptide sequence was selected from the C terminal of DKKL1. Peptide sequence DALEGGHWLSEKRHRLQAIRDGLRKGTHKDVLEEGTESSSHSRLSPRKTH. The peptide sequence for this immunogen was taken from within the described region. |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
DKKL1 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
|
| Theoretical MW |
27 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS, 2% Sucrose |
| Preservative |
0.09% Sodium Azide |
| Concentration |
0.5 mg/ml |
| Purity |
Affinity purified |
Alternate Names for Soggy-1/DkkL1 Antibody - BSA Free
Background
The dickkopf protein family interacts with the Wnt signaling pathway and its members are characterized by two conserved cysteine-rich domains. DKKL1 is a secreted protein that has high similarity to the N-terminus of the dickkopf-3 protein and moderate similarity to that protein's C-terminus though the C-terminal cysteine residues are not conserved.The dickkopf protein family interacts with the Wnt signaling pathway and its members are characterized by two conserved cysteine-rich domains. This gene encodes a secreted protein that has high similarity to the N-terminus of the dickkopf-3 protein and moderate similarity to that protein's C-terminus though the C-terminal cysteine residues are not conserved.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: BA
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ChIP-EXO-SEQ, ICC/IF
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Mu
Applications: CyTOF-ready, Flow, IHC, WB
Species: Hu
Applications: BA
Species: Mu
Applications: BA
Species: Hu
Applications: CyTOF-ready, Flow, ICC
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: Flow, IHC, IHC-P, WB
Species: Ha, Hu, Mu, Rt
Applications: ICC/IF, IP, WB
Species: Hu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), ELISA, IHC
Species: Mu
Applications: IHC, WB
Species: Hu
Applications: BA
Species: Ca, Hu, Pm, Mu, Pm, Rt
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: WB
Publications for Soggy-1/DkkL1 Antibody (NBP1-69688) (0)
There are no publications for Soggy-1/DkkL1 Antibody (NBP1-69688).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Soggy-1/DkkL1 Antibody (NBP1-69688) (0)
There are no reviews for Soggy-1/DkkL1 Antibody (NBP1-69688).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Soggy-1/DkkL1 Antibody (NBP1-69688) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Soggy-1/DkkL1 Products
Blogs on Soggy-1/DkkL1