SNRNP25 Antibody


Western Blot: SNRNP25 Antibody [NBP2-32028] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10, Lane 2: Human cell line MCF-7
Immunohistochemistry-Paraffin: SNRNP25 Antibody [NBP2-32028] - Staining of human cerebellum shows strong cytoplasmic positivity in Purkinje cells and cells in granular layer.

Product Details

Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P

Order Details

SNRNP25 Antibody Summary

This antibody was developed against a recombinant protein corresponding to amino acids: EEALPHSEAMDVFQEGLAMVVQDPLLCDLPIQVTLEEVNSQIALEYGQAMTVRVCKMDGEV
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:500 - 1:1000
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
SNRNP25 Protein (NBP2-32028PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for SNRNP25 Antibody

  • C16orf33
  • chromosome 16 open reading frame 33
  • FLJ22940
  • Minus-99 protein
  • small nuclear ribonucleoprotein 25kDa (U11/U12)
  • U11/U12 small nuclear ribonucleoprotein 25 kDa protein
  • U11/U12 snRNP 25 kDa protein
  • U11/U12 snRNP 25K
  • U11/U12-25K


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ChIP, ELISA
Species: Hu
Applications: WB
Species: Hu
Applications: WB, IHC, IHC-P

Publications for SNRNP25 Antibody (NBP2-32028) (0)

There are no publications for SNRNP25 Antibody (NBP2-32028).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SNRNP25 Antibody (NBP2-32028) (0)

There are no reviews for SNRNP25 Antibody (NBP2-32028). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SNRNP25 Antibody (NBP2-32028) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional SNRNP25 Products

Bioinformatics Tool for SNRNP25 Antibody (NBP2-32028)

Discover related pathways, diseases and genes to SNRNP25 Antibody (NBP2-32028). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on SNRNP25

There are no specific blogs for SNRNP25, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our SNRNP25 Antibody and receive a gift card or discount.


Gene Symbol SNRNP25