SLC9A10 Antibody

Western Blot: SLC9A10 Antibody [NBP1-74199] - Rat Brain Lysate 1ug/ml Gel Concentration 6-18%

Product Discontinued

SLC9A10 Antibody Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to the middle region of Slc9a10. Immunizing peptide sequence IQEKAKVVTFDCGNNIFEEGDEPEGIYVIISGMVKLKRSKPHLEMDRVSS. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SLC9C1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for SLC9A10 Antibody

• isoform 10
• Solute carrier family 9 member 10
• solute carrier family 9, member 10

Background

The function of this protein remains unknown.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SLC9C1