SLC9A10 Antibody

Images

 
Western Blot: SLC9A10 Antibody [NBP1-74199] - Rat Brain Lysate 1ug/ml Gel Concentration 6-18%

Product Details

Summary
Reactivity RtSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SLC9A10 Antibody Summary

Immunogen
Synthetic peptides corresponding to the middle region of Slc9a10. Immunizing peptide sequence IQEKAKVVTFDCGNNIFEEGDEPEGIYVIISGMVKLKRSKPHLEMDRVSS.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SLC9C1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against Slc9a10 and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for SLC9A10 Antibody

  • isoform 10
  • Solute carrier family 9 member 10
  • solute carrier family 9, member 10

Background

The function of this protein remains unknown.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-33736
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-81765
Species: Hu
Applications: IHC, IHC-P
NBP1-59901
Species: Hu
Applications: WB, IHC, IHC-P
NB300-536
Species: Hu, Mu, Rt, Ca
Applications: WB, IHC, IHC-P, IP, IF
NBP2-25162
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
H00117144-P01
Species: Hu
NBP2-38877
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-05819
Species: Hu
NBP1-91790
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-69123
Species: Hu, Mu, Rt
Applications: WB
NBP2-13347
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-30656
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P
NBP1-81933
Species: Hu
Applications: IHC, IHC-P
NBP1-81586
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB120-2941
Species: Hu, Mu, Rt, Bv, Pm
Applications: WB, IHC, IHC-P
NBP2-24449
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow
MAB8404
Species: Hu
Applications: Flow, CyTOF-ready
AF7899
Species: Hu
Applications: WB, IHC

Publications for SLC9A10 Antibody (NBP1-74199) (0)

There are no publications for SLC9A10 Antibody (NBP1-74199).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SLC9A10 Antibody (NBP1-74199) (0)

There are no reviews for SLC9A10 Antibody (NBP1-74199). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SLC9A10 Antibody (NBP1-74199) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SLC9A10 Products

SLC9A10 NBP1-74199

Bioinformatics Tool for SLC9A10 Antibody (NBP1-74199)

Discover related pathways, diseases and genes to SLC9A10 Antibody (NBP1-74199). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on SLC9A10

There are no specific blogs for SLC9A10, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SLC9A10 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SLC9C1