SLC9A10 Antibody


Western Blot: SLC9A10 Antibody [NBP1-74199] - Rat Brain Lysate 1ug/ml Gel Concentration 6-18%

Product Details

Reactivity Rt, Hu, Po, Bv, Ca, RbSpecies Glossary
Applications WB

Order Details

SLC9A10 Antibody Summary

Synthetic peptides corresponding to the middle region of Slc9a10. Immunizing peptide sequence IQEKAKVVTFDCGNNIFEEGDEPEGIYVIISGMVKLKRSKPHLEMDRVSS.
Predicted Species
Human (100%), Porcine (93%), Bovine (93%), Rabbit (100%), Canine (100%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against Slc9a10 and was validated on Western blot.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for SLC9A10 Antibody

  • isoform 10
  • Solute carrier family 9 member 10
  • solute carrier family 9, member 10


The function of this protein remains unknown.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
Species: Hu
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Mu, Rt
Applications: WB
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: WB
Species: Hu, Mu
Applications: WB
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: Flow, CyTOF-ready
Species: Hu
Applications: WB, IHC
Species: Rt, Hu, Po, Bv, Ca, Rb
Applications: WB

Publications for SLC9A10 Antibody (NBP1-74199) (0)

There are no publications for SLC9A10 Antibody (NBP1-74199).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SLC9A10 Antibody (NBP1-74199) (0)

There are no reviews for SLC9A10 Antibody (NBP1-74199). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SLC9A10 Antibody (NBP1-74199) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Other Available Formats

Additional SLC9A10 Products

Array NBP1-74199

Bioinformatics Tool for SLC9A10 Antibody (NBP1-74199)

Discover related pathways, diseases and genes to SLC9A10 Antibody (NBP1-74199). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on SLC9A10

There are no specific blogs for SLC9A10, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our SLC9A10 Antibody and receive a gift card or discount.


Gene Symbol SLC9C1