SLC8A2 Antibody - Azide and BSA Free

Western Blot: SLC8A2 Antibody [NBP2-93474] - Analysis of extracts of various cell lines, using SLC8A2 at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit . Exposure time: 10s.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: Azide and BSA Free

SLC8A2 Antibody - Azide and BSA Free Summary

• Description: Novus Biologicals Rabbit SLC8A2 Antibody - Azide and BSA Free (NBP2-93474) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 360-450 of human SLC8A2 (NP_055878.1). LMTGAGNVLRRHAADASRRAAPAEGAGEDEDDGASRIFFEPSLYHCLENCGSVLLSVTCQGGEGNSTFYVDYRTEDGSAKAGSDYEYSEGT
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SLC8A2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1:500-1:2000
• Theoretical MW: 100 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.01% Thimerosal
• Purity: Affinity purified

Alternate Names for SLC8A2 Antibody - Azide and BSA Free

• KIAA1087
• Na(+)/Ca(2+)-exchange protein 2
• Na+/Ca2+-exchanging protein Nac2
• NCX2
• SLC8A2
• sodium/calcium exchanger 2
• sodium-calcium exchanger 2
• solute carrier family 8 (sodium/calcium exchanger), member 2
• solute carrier family 8 (sodium-calcium exchanger), member 2
• solute carrier family 8 member 2

Background

Rapidly transports Ca(2+) during excitation-contraction coupling. Ca(2+) is extruded from the cell during relaxation so as to prevent overloading of intracellular stores

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Bioinformatics

• Gene Symbol: SLC8A2