SLC25A34 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: SLC25A34 Antibody [NBP2-55708] - Staining of human cell line SK-MEL-30 shows localization to mitochondria.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SLC25A34 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: PFDVVSTRLYNQPVDTAGRGQLYGGLTDCMVKIWRQEGPLALYKGLG
Specificity
Specificity of human SLC25A34 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SLC25A34
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
SLC25A34 Recombinant Protein Antigen (NBP2-55708PEP)

Reactivity Notes

Mouse 85%, Rat 87%

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for SLC25A34 Antibody

  • DKFZp781A10161
  • RP11-169K16.2
  • solute carrier family 25 member 34
  • solute carrier family 25, member 34

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-13324
Species: Hu
Applications: ICC/IF
NBP1-93525
Species: Hu
Applications: IHC, IHC-P
NBP1-93778
Species: Hu
Applications: IHC, IHC-P
NBP2-30521
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-13323
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-65594
Species: Hu
NBP2-13325
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-59566
Species: Hu
Applications: WB
NBP2-65574
Species: Hu
NBP1-86310
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-30976
Species: Hu
Applications: IHC, IHC-P
NBP2-56950
Species: Hu
Applications: ICC/IF
NBP2-65744
Species: Hu
NBP2-55708
Species: Hu
Applications: ICC/IF

Publications for SLC25A34 Antibody (NBP2-55708) (0)

There are no publications for SLC25A34 Antibody (NBP2-55708).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SLC25A34 Antibody (NBP2-55708) (0)

There are no reviews for SLC25A34 Antibody (NBP2-55708). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for SLC25A34 Antibody (NBP2-55708) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for SLC25A34 Antibody (NBP2-55708)

Discover related pathways, diseases and genes to SLC25A34 Antibody (NBP2-55708). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SLC25A34 Antibody (NBP2-55708)

Discover more about diseases related to SLC25A34 Antibody (NBP2-55708).
 

Pathways for SLC25A34 Antibody (NBP2-55708)

View related products by pathway.

Blogs on SLC25A34

There are no specific blogs for SLC25A34, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SLC25A34 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SLC25A34