SLC17A4 Antibody

Images

 
Immunohistochemistry-Paraffin: SLC17A4 Antibody [NBP2-57090] - Immunohistochemical staining of human liver shows strong membranous positivity in hepatocytes.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SLC17A4 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: YDDPVNHPFISAGEKRYIVCSLAQQDCSPGWSLPIRA
Specificity
Specificity of human SLC17A4 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SLC17A4
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide

Reactivity Notes

Mouse 81%, Rat 84%

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for SLC17A4 Antibody

  • KAIA2138
  • KIAA2138
  • MGC129623
  • Na/PO4 cotransporter
  • putative small intestine sodium-dependent phosphate transport protein
  • solute carrier family 17 (sodium phosphate), member 4
  • Solute carrier family 17 member 4

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-60014
Species: Hu, Bv, Eq
Applications: WB
NBP1-80917
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-82501
Species: Hu
Applications: IHC, IHC-P
NBP2-02984
Species: Hu, Rt, Ca, Mk, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-05054
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-31030
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-30117
Species: Hu, Mu
Applications: WB, IHC, IP
NB120-11012
Species: Hu, Bv(-), Ca(-), Eq(-), Gp(-), Mu(-), Po(-)
Applications: WB, ELISA, ICC/IF, IP

Publications for SLC17A4 Antibody (NBP2-57090) (0)

There are no publications for SLC17A4 Antibody (NBP2-57090).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SLC17A4 Antibody (NBP2-57090) (0)

There are no reviews for SLC17A4 Antibody (NBP2-57090). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for SLC17A4 Antibody (NBP2-57090) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional SLC17A4 Products

Bioinformatics Tool for SLC17A4 Antibody (NBP2-57090)

Discover related pathways, diseases and genes to SLC17A4 Antibody (NBP2-57090). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SLC17A4 Antibody (NBP2-57090)

Discover more about diseases related to SLC17A4 Antibody (NBP2-57090).
 

Pathways for SLC17A4 Antibody (NBP2-57090)

View related products by pathway.

Blogs on SLC17A4

There are no specific blogs for SLC17A4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SLC17A4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SLC17A4