SH3RF2 Antibody (4E10) - Azide and BSA Free

Western Blot: SH3RF2 Antibody (4E10) [H00153769-M01] - SH3RF2 monoclonal antibody (M01), clone 4E10 Western Blot analysis of SH3RF2 expression in Hela NE ( Cat # L013V3 ).

Sandwich ELISA: SH3RF2 Antibody (4E10) [H00153769-M01] - Detection limit for recombinant GST tagged SH3RF2 is approximately 0.03ng/ml as a capture antibody.

• Reactivity: Hu, Rt
• Applications: WB, ELISA
• Clone: 4E10
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

SH3RF2 Antibody (4E10) - Azide and BSA Free Summary

• Immunogen: SH3RF2 (NP_660205, 640 a.a. ~ 729 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. VKTVRFQNYSPPPTKHYTSHPTSGKPEQPATLKASQPEAASLGPEMTVLFAHRSGCHSGQQTDLRRKSALAKATTLVSTASGTQTVFPSK
• Specificity: SH3RF2 - SH3 domain containing ring finger 2
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: SH3RF2
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Sandwich ELISA
  • Western Blot 1:500
• Application Notes: Antibody reactive against cell lysate and recombinant protein for western blot. It has also been used for ELISA.

Reactivity Notes

Human. Other species not tested.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for SH3RF2 Antibody (4E10) - Azide and BSA Free

• EC 6.3.2
• EC 6.3.2.-
• Heart protein phosphatase 1-binding protein
• HEPP1FLJ23654
• MGC149788
• MGC149789
• putative E3 ubiquitin-protein ligase SH3RF2
• RING finger protein 158
• RNF158MGC90410
• SH3 domain containing ring finger 2
• SH3 domain-containing RING finger protein 2

Background

RNF158 may be a E3 ubiquitin-protein ligase (Potential)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for SH3RF2 Antibody (H00153769-M01)(3)

Publications using H00153769-M01

• Chen JQ, Gao SQ, Luo L et al. Nonoxid-HMGB1 Attenuates Cognitive Impairment After Traumatic Brain Injury in Rats Frontiers in medicine [PMID: 35479959] (ICC/IF, Rat)
• Kim TW, Kang YK, Park ZY et al. SH3RF2 functions as an oncogene by mediating PAK4 protein stability. Carcinogenesis. 2014-03-01 [PMID: 24130170] (Human)
• Wilhelm M, Kukekov NV, Schmit TL et al. Sh3rf2/POSHER promotes cell survival by RING-mediated proteasomal degradation of the JNK scaffold POSH. J Biol Chem. 2011-11-28 [PMID: 22128169]

Bioinformatics

• Gene Symbol: SH3RF2
• Entrez:
  • 153769(Human)
• Uniprot:
  • NP_689763.2(Human)