Recombinant Human SGTB Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human SGTB Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-304 of Human SGTB full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MSSIKHLVYAVIRFLREQSQMDTYTSDEQESLEVAIQCLETVFKISPEDTHLAVSQPLTEMFTSSFCKNDVLPLSNSVPEDVGKADQLKDEGNNHMKEENYAAAVDCYTQAIELDPNNAVYYCNRAAAQSKLGHYTDAIKDCEKAIAIDSKYSKAYGRMGLALTALNKFEEAVTSYQKALDLDPENDSYKSNLKIAEQKLREVSSPTGTGLSFDMASLINNPAFISMAASLMQNPQVQQLMSGMMTNAIGGPAAGVGGLTDLSSLIQAGQQFAQQIQQQNPELIEQLRNHIRSRSFSSSAEEHS

Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Recombinant Protein
Gene
SGTB
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Theoretical MW
59.8 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human SGTB Protein

  • beta-SGT
  • FLJ39002
  • SGT2
  • small glutamine rich protein with tetratricopeptide repeats 2
  • Small glutamine-rich protein with tetratricopeptide repeats 2
  • small glutamine-rich tetratricopeptide repeat (TPR)-containing, beta
  • small glutamine-rich tetratricopeptide repeat-containing protein beta

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-84956
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-86732
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00006449-M06
Species: Hu
Applications: WB, ELISA, ICC/IF, IP
H00000439-M03
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF, IHC-P, RNAi
NBP1-33548
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-38707
Species: Hu
Applications: IHC, IHC-P
NB100-2322
Species: Hu, Mu, Rt, Bv, Ca, Rb, Sh
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC, IHC-P, Flow-IC
NBP2-33278
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-67817
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF6438
Species: Hu, Mu, Rt
Applications: WB, ICC
NBP2-38518
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-2866
Species: Hu
Applications: WB, ICC/IF, IP, KO
NBP1-85010
Species: Hu
Applications: WB, IHC, IHC-P
AF5687
Species: Hu, Rt
Applications: WB, Simple Western, IHC, ICC
NBP1-91996
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NBP1-85383
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for SGTB Recombinant Protein (H00054557-P01) (0)

There are no publications for SGTB Recombinant Protein (H00054557-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SGTB Recombinant Protein (H00054557-P01) (0)

There are no reviews for SGTB Recombinant Protein (H00054557-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SGTB Recombinant Protein (H00054557-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Array Products

Bioinformatics Tool for SGTB Recombinant Protein (H00054557-P01)

Discover related pathways, diseases and genes to SGTB Recombinant Protein (H00054557-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SGTB Recombinant Protein (H00054557-P01)

Discover more about diseases related to SGTB Recombinant Protein (H00054557-P01).
 

Pathways for SGTB Recombinant Protein (H00054557-P01)

View related products by pathway.

Blogs on SGTB

There are no specific blogs for SGTB, but you can read our latest blog posts.

Customers Who Bought This Also Bought

SGTB Antibody
NBP2-38998
TPR Antibody
NB100-2866

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human SGTB Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol SGTB