Recombinant Human SGK2 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human SGK2 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-367 of Human SGK2 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MNSSPAGTPSPQPSRANGNINLGPSANPNAQPTDFDFLKVIGKGNYGKVLLAKRKSDGAFYAVKVLQKKSILKKKEQSHIMAERSVLLKNVRHPFLVGLRYSFQTPEKLYFVLDYVNGGELFFHLQRERRFLEPRARFYAAEVASAIGYLHSLNIIYRDLKPENILLDCQGHVVLTDFGLCKEGVEPEDTTSTFCGTPEYLAPEVLRKEPYDRAVDWWCLGAVLYEMLHGLPPFYSQDVSQMYENILHQPLQIPGGRTVAACDLLQSLLHKDQRQRLGSKADFLEIKNHVFFSPINWDDLYHKRLTPPFNPNVTGPADLKHFDPEFTQEAVSKSIGCTPDTVASSSGASSAFLGFSYAPEDDDILDC

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
SGK2

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human SGK2 Protein

  • dJ138B7.2
  • EC 2.7.11
  • EC 2.7.11.1
  • H-SGK2
  • serine/threonine-protein kinase Sgk2
  • serum/glucocorticoid regulated kinase 2
  • Serum/glucocorticoid-regulated kinase 2
  • SGK2
  • Sgkl

Background

This gene encodes a serine/threonine protein kinase. Although this gene product is similar to serum- and glucocorticoid-induced protein kinase (SGK), this gene is not induced by serum or glucocorticoids. This gene is induced in response to signals that activate phosphatidylinositol 3-kinase, which is also true for SGK. Two alternate transcripts encoding two different isoforms have been described. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-19010
Species: Hu
Applications: WB, IHC, IHC-P
NLS7240
Species: Hu, Mu, Rt, Bt, Ca, Ha
Applications: IHC-P
NBP1-91228
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-54974
Species: Hu
Applications: WB
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB110-81529
Species: Hu, Mu, Rt, Op, Pm, Rb
Applications: WB, Simple Western, ELISA, ICC/IF, IHC, IP, IF
MAB864
Species: Hu, Mu, Rt
Applications: WB, ICC
NB100-2383
Species: Hu
Applications: WB, ICC/IF
NB100-2450
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP2-12897
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
H00003753-M01
Species: Hu
Applications: WB, ELISA, RNAi
H00003738-M01
Species: Hu
Applications: WB, ELISA
NBP2-48740
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-84938
Species: Hu
Applications: IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NB100-93520
Species: Hu
Applications: WB, ICC/IF, PEP-ELISA
NBP1-62518
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-60082
Species: Hu
Applications: WB, IHC, IHC-P

Publications for SGK2 Recombinant Protein (H00010110-P01) (0)

There are no publications for SGK2 Recombinant Protein (H00010110-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SGK2 Recombinant Protein (H00010110-P01) (0)

There are no reviews for SGK2 Recombinant Protein (H00010110-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SGK2 Recombinant Protein (H00010110-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional SGK2 Products

Bioinformatics Tool for SGK2 Recombinant Protein (H00010110-P01)

Discover related pathways, diseases and genes to SGK2 Recombinant Protein (H00010110-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SGK2 Recombinant Protein (H00010110-P01)

Discover more about diseases related to SGK2 Recombinant Protein (H00010110-P01).
 

Pathways for SGK2 Recombinant Protein (H00010110-P01)

View related products by pathway.

PTMs for SGK2 Recombinant Protein (H00010110-P01)

Learn more about PTMs related to SGK2 Recombinant Protein (H00010110-P01).
 

Research Areas for SGK2 Recombinant Protein (H00010110-P01)

Find related products by research area.

Blogs on SGK2

There are no specific blogs for SGK2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

SGK2 Antibody
NBP1-86102

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human SGK2 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol SGK2
Entrez