SGK2 Antibody (2F6)

Images

 
Western Blot: SGK2 Antibody (2F6) [H00010110-M07] - Analysis of SGK2 expression in IMR-32 (Cat # L008V1).
Immunocytochemistry/ Immunofluorescence: SGK2 Antibody (2F6) [H00010110-M07] - Analysis of monoclonal antibody to SGK2 on HeLa cell. Antibody concentration 30 ug/ml
Sandwich ELISA: SGK2 Antibody (2F6) [H00010110-M07] - Detection limit for recombinant GST tagged SGK2 is approximately 0.03ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF, S-ELISA
Clone
2F6
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

SGK2 Antibody (2F6) Summary

Immunogen
SGK2 (AAH65511, 293 a.a. ~ 367 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SPINWDDLYHKRLTPPFNPNVTGPADLKHFDPEFTQEAVSKSIGCTPDTVASSSGASSAFLGFSYAPEDDDILDC
Specificity
SGK2 (2F6)
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
SGK2
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Sandwich ELISA
  • Western Blot 1:500
Application Notes
Antibody reactive against cell lysate and recombinant protein for Western Blot. Has also been used for immunofluoresence and ELISA.

Reactivity Notes

Human. Other species not tested.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for SGK2 Antibody (2F6)

  • dJ138B7.2
  • EC 2.7.11
  • EC 2.7.11.1
  • H-SGK2
  • serine/threonine-protein kinase Sgk2
  • serum/glucocorticoid regulated kinase 2
  • Serum/glucocorticoid-regulated kinase 2
  • SGK2
  • Sgkl

Background

This gene encodes a serine/threonine protein kinase. Although this gene product is similar to serum- and glucocorticoid-induced protein kinase (SGK), this gene is not induced by serum or glucocorticoids. This gene is induced in response to signals that activate phosphatidylinositol 3-kinase, which is also true for SGK. Two alternate transcripts encoding two different isoforms have been described.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00006446-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, KD, WB
NBP3-12271
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
MAB6210
Species: Hu
Applications: Simple Western, WB
H00023327-P01
Species: Hu
Applications: ELISA, AP, PA, WB
AF887
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
NB110-81529
Species: Hu, Mu, Ma-Op, Po, Pm, Rb, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IP, KD, KO, Simple Western, WB
MAB864
Species: Hu, Mu, Rt
Applications: ICC, WB
NB100-2383
Species: Hu
Applications: ICC/IF, WB
NB100-2450
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA, WB
NBP2-12897
Species: Ha, Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, MiAr, WB
H00003753-M01
Species: Ca, Gp, Hu, Pm, Rt
Applications: ELISA, ICC/IF, KD, WB
H00003738-M01
Species: Hu
Applications: ELISA, WB
NBP3-13360
Species: Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P
NBP3-17050
Species: Hu
Applications: IHC, IHC-P
MAB1417
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
NBP1-82604
Species: Hu
Applications: IHC, IHC-P
NBP2-11567
Species: Hu, Mu
Applications: IHC, IHC-P, PEP-ELISA, WB
H00010110-M07
Species: Hu
Applications: WB, ELISA, ICC/IF, S-ELISA

Publications for SGK2 Antibody (H00010110-M07) (0)

There are no publications for SGK2 Antibody (H00010110-M07).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SGK2 Antibody (H00010110-M07) (0)

There are no reviews for SGK2 Antibody (H00010110-M07). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for SGK2 Antibody (H00010110-M07) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SGK2 Products

Bioinformatics Tool for SGK2 Antibody (H00010110-M07)

Discover related pathways, diseases and genes to SGK2 Antibody (H00010110-M07). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SGK2 Antibody (H00010110-M07)

Discover more about diseases related to SGK2 Antibody (H00010110-M07).
 

Pathways for SGK2 Antibody (H00010110-M07)

View related products by pathway.

PTMs for SGK2 Antibody (H00010110-M07)

Learn more about PTMs related to SGK2 Antibody (H00010110-M07).
 

Research Areas for SGK2 Antibody (H00010110-M07)

Find related products by research area.

Blogs on SGK2

There are no specific blogs for SGK2, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SGK2 Antibody (2F6) and receive a gift card or discount.

Bioinformatics

Gene Symbol SGK2
Entrez
OMIM
Uniprot