SFT2B Antibody

Images

 
Western Blot: SFT2B Antibody [NBP1-88013] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed with ...read more
Immunohistochemistry: SFT2B Antibody [NBP1-88013] - Staining of human prostate shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SFT2B Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:MDKLKKVLSGQDTEDRSGLSEVVEASSLSWSTR
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (97%), Rat (97%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SFT2D2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
SFT2B Protein (NBP1-88013PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SFT2B Antibody

  • dJ747L4.C1.2
  • FLJ34085
  • SFT2 domain containing 2
  • SFT2 domain-containing protein 2
  • UNQ512
  • vesicle transport protein SFT2B

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-28875
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB100-55735
Species: Hu, Mu, Bv, Ca, Ch, Pm
Applications: WB, ICC/IF, IP
NBP2-13382
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88013
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for SFT2B Antibody (NBP1-88013) (0)

There are no publications for SFT2B Antibody (NBP1-88013).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SFT2B Antibody (NBP1-88013) (0)

There are no reviews for SFT2B Antibody (NBP1-88013). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SFT2B Antibody (NBP1-88013) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SFT2B Products

SFT2B NBP1-88013

Bioinformatics Tool for SFT2B Antibody (NBP1-88013)

Discover related pathways, diseases and genes to SFT2B Antibody (NBP1-88013). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on SFT2B

There are no specific blogs for SFT2B, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SFT2B Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SFT2D2