We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

SFRS14 Recombinant Protein Antigen

Images

 
There are currently no images for SFRS14 Protein (NBP1-87868PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

SFRS14 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human SUGP2.

Source: E. coli

Amino Acid Sequence: DQLVKRVIEGSLSPKERTLLKEDPAYWFLSDENSLEYKYYKLKLAEMQRMSENLRGADQKPTSADCAVRAMLYSRAVRNLKKKLL

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
SUGP2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-87868.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for SFRS14 Recombinant Protein Antigen

  • Arginine/serine-rich-splicing factor 14
  • DKFZp686M2322
  • DKFZp779L2418
  • KIAA0365arginine/serine-rich 14 splicing factor
  • putative splicing factor, arginine/serine-rich 14
  • SFRS14
  • Splicing factor, arginine/serine-rich 14FLJ21855
  • SRFS14
  • SURP and G patch domain containing 2
  • SURP and G-patch domain-containing protein 2

Background

SFRS14 (splicing factor arginine/serine-rich 14) is a putative alternative splicing factor. It contains two SURP motif repeats which are found among proteins involved in regulated mRNA splicing and a G-patch domain which features six highly conserved glycine residues found in several RNA-associated proteins. SFRS14 also bears an N-terminal arginine/serine-rich region found among the SR-related family of pre-mRNA processing factors. SFRS14 is also known as KIAA0365.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-88000
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, KD, WB
NB100-1761
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, IP, KO, WB
NB100-55245
Species: Hu
Applications: IHC,  IHC-P, IP, WB
NBP3-03747
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
NB200-333
Species: Hu
Applications: IHC,  IHC-P, IP, WB
H00005725-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC,  IHC-P, IP, Single-Cell Western, WB
NBP2-38956
Species: Hu
Applications: ChIP, IHC,  IHC-P, Simple Western, WB
NBP2-14998
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB

Publications for SFRS14 Protein (NBP1-87868PEP) (0)

There are no publications for SFRS14 Protein (NBP1-87868PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SFRS14 Protein (NBP1-87868PEP) (0)

There are no reviews for SFRS14 Protein (NBP1-87868PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for SFRS14 Protein (NBP1-87868PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional SFRS14 Products

Array NBP1-87868PEP

Blogs on SFRS14

There are no specific blogs for SFRS14, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our SFRS14 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol SUGP2