Recombinant Human SFRS14 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human SFRS14 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 579-674 of Human SFRS14 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:PQRADHRVVGTIDQLVKRVIEGSLSPKERTLLKEDPAYWFLSDENSLEYKYYKLKLAEMQRMSENLRGADQKPTSADCAVRAMLYSRAVRNLKKKL

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
SUGP2

Applications/Dilutions

Dilutions
  • Western Blot Western Blot
Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human SFRS14 Protein

  • Arginine/serine-rich-splicing factor 14
  • DKFZp686M2322
  • DKFZp779L2418
  • KIAA0365arginine/serine-rich 14 splicing factor
  • putative splicing factor, arginine/serine-rich 14
  • SFRS14
  • Splicing factor, arginine/serine-rich 14FLJ21855
  • SRFS14
  • SURP and G patch domain containing 2
  • SURP and G-patch domain-containing protein 2

Background

SFRS14 - splicing factor, arginine/serine-rich 14

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-88000
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-1761
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB100-55245
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP1-71833
Species: Hu, Mu
Applications: WB
NBP1-88200
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00005725-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, IP
NBP2-38956
Species: Hu
Applications: WB, Simple Western, IHC, IHC-P
NBP2-14998
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for SFRS14 Partial Recombinant Protein (H00010147-Q01) (0)

There are no publications for SFRS14 Partial Recombinant Protein (H00010147-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SFRS14 Partial Recombinant Protein (H00010147-Q01) (0)

There are no reviews for SFRS14 Partial Recombinant Protein (H00010147-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SFRS14 Partial Recombinant Protein (H00010147-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional SFRS14 Products

Bioinformatics Tool for SFRS14 Partial Recombinant Protein (H00010147-Q01)

Discover related pathways, diseases and genes to SFRS14 Partial Recombinant Protein (H00010147-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on SFRS14

There are no specific blogs for SFRS14, but you can read our latest blog posts.

Customers Who Bought This Also Bought

SFRS14 Antibody
NB100-79849
PTBP1 Antibody (3H8)
H00005725-M01

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human SFRS14 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol SUGP2