SETD6 Antibody

Images

 
Western Blot: SETD6 Antibody [NBP2-88244] - WB Suggested Anti-SETD6 Antibody Titration: 0.2-1 ug/ml. Positive Control: THP-1 cell lysate

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Concentration
0.5 mg/ml

Order Details

SETD6 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human SETD6. Peptide sequence: ELKDQDGGGDDKREEGSLTITNIPKLKASWRQLLQNSVLLTLQTYATDLK The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
SETD6
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Concentration
0.5 mg/ml
Purity
Affinity purified

Alternate Names for SETD6 Antibody

  • SET domain containing 6
  • SET domain-containing protein 6

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

PP-B0422-00
Species: Hu, Mu
Applications: DirELISA, IHC, IP, WB
NBP2-29661
Species: Hu, Mu, Rt
Applications: ELISA
NB100-2436
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA, WB
NBP2-20116
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NB500-171
Species: Hu, I, Mu, Rt, Xp, Ye
Applications: ChIP, IB, ICC/IF, IHC, IHC-P, Single-Cell Western, WB
NBP2-88244
Species: Hu
Applications: WB

Publications for SETD6 Antibody (NBP2-88244) (0)

There are no publications for SETD6 Antibody (NBP2-88244).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SETD6 Antibody (NBP2-88244) (0)

There are no reviews for SETD6 Antibody (NBP2-88244). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SETD6 Antibody (NBP2-88244) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SETD6 Products

Diseases for SETD6 Antibody (NBP2-88244)

Discover more about diseases related to SETD6 Antibody (NBP2-88244).
 

Pathways for SETD6 Antibody (NBP2-88244)

View related products by pathway.

PTMs for SETD6 Antibody (NBP2-88244)

Learn more about PTMs related to SETD6 Antibody (NBP2-88244).

Blogs on SETD6

There are no specific blogs for SETD6, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SETD6 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SETD6