Recombinant Human SEC6 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human SEC6 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 646-745 of Human SEC6L1 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:SGFGEDVDGYCDTIVAVAEVIKLTDPSLLYLEVSTLVSKYPDIRDDHIGALLAVRGDASRDMKQTIMETLEQGPAQASPSYVPLFKDIVVPSLNVAKLLK

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
EXOC3
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human SEC6 Protein

  • exocyst complex component 3
  • Exocyst complex component Sec6
  • Sec 6 homolog
  • SEC6
  • SEC6L1
  • SEC6-like 1 (S. cerevisiae)
  • SEC6-like 1
  • Sec6p

Background

EXOC3 - SEC6-like 1 (S. cerevisiae)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-97492
Species: Hu, Mu, Rt, Bv, Ca, Ch, Fi, GP, Ha, Pm, Rb, Sh
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-83786
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84767
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85031
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
AF3204
Species: Hu, Mu, Rt
Applications: WB
NBP2-31841
Species: Hu
Applications: IHC, IHC-P
NBP1-89957
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-49533
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-00795
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
H00023433-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP1-91444
Species: Hu
Applications: WB
NBP1-85731
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-49320
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for SEC6 Partial Recombinant Protein (H00011336-Q01) (0)

There are no publications for SEC6 Partial Recombinant Protein (H00011336-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SEC6 Partial Recombinant Protein (H00011336-Q01) (0)

There are no reviews for SEC6 Partial Recombinant Protein (H00011336-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SEC6 Partial Recombinant Protein (H00011336-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional SEC6 Products

Bioinformatics Tool for SEC6 Partial Recombinant Protein (H00011336-Q01)

Discover related pathways, diseases and genes to SEC6 Partial Recombinant Protein (H00011336-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SEC6 Partial Recombinant Protein (H00011336-Q01)

Discover more about diseases related to SEC6 Partial Recombinant Protein (H00011336-Q01).
 

Pathways for SEC6 Partial Recombinant Protein (H00011336-Q01)

View related products by pathway.

PTMs for SEC6 Partial Recombinant Protein (H00011336-Q01)

Learn more about PTMs related to SEC6 Partial Recombinant Protein (H00011336-Q01).

Blogs on SEC6

There are no specific blogs for SEC6, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Glut4 Antibody
NBP1-49533
SEC6 Antibody (9H5)
NBP1-97500-0.05mg

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human SEC6 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol EXOC3