Recombinant Human SEC14L4 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human SEC14L4 Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1 - 352 of Human SEC14L4 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MLRRHMEFRKQQDLDNIVTWQPPEVIQLYDSGGLCGYDYEGCPVYFNIIGSLDPKGLLLSASKQDMIRKRIKVCELLLHECELQTQKLGRKIEMALMVFDMEGLSLKHLWKPAVEVYQQFFSILEANYPETLKNLIVIRAPKLFPVAFNLVKSFMSEETRRKIVILGDNWKQELTKFISPDQLPVEFGGTMTDPDGNPKCLTKINYGGEVPKSYYLCEQVRLQYEHTRSVGRGSSLQVENEILFPGCVLRWQFASDGGDIGFGVFLKTKMGEQQSAREMTEVLPSQRYNAHMVPEDGSLTCLQAGVYVLRFDNTYSRMHAKKLSYTVEVLLPDKASEETLQSLKAMRPSPTQ

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
SEC14L4

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human SEC14L4 Protein

  • dJ130H16.5
  • SEC14-like 4 (S. cerevisiae)
  • SEC14p-like protein TAP3
  • TAP3SEC14-like protein 4
  • Tocopherol-associated protein 3

Background

The protein encoded by this gene is highly similar to the protein encoded by the Saccharomyces cerevisiae SEC14 gene. The SEC14 protein is a phophatidylinositol transfer protein that is essential for biogenesis of Golgi-derived transport vesicles, and thus is required for the export of yeast secretory proteins from the Golgi complex. The specific function of this protein has not yet been determined. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-01346
Species: Hu, Mu, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-31769
Species: Hu
Applications: IHC, IHC-P
AF1837
Species: Hu
Applications: WB, Simple Western, ICC
NBP1-80882
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-490
Species: Hu, Mu
Applications: WB, ICC/IF
NBP2-15304
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
AF3444
Species: Hu
Applications: WB
NBP2-49341
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-90286
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-54435
Species: Hu
Applications: WB, Flow, IP
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP1-89312
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-85855
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-38401
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-32470
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P
H00284904-P01
Species: Hu
Applications: WB, ELISA, PA

Publications for SEC14L4 Recombinant Protein (H00284904-P01) (0)

There are no publications for SEC14L4 Recombinant Protein (H00284904-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SEC14L4 Recombinant Protein (H00284904-P01) (0)

There are no reviews for SEC14L4 Recombinant Protein (H00284904-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SEC14L4 Recombinant Protein (H00284904-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional SEC14L4 Products

Bioinformatics Tool for SEC14L4 Recombinant Protein (H00284904-P01)

Discover related pathways, diseases and genes to SEC14L4 Recombinant Protein (H00284904-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Pathways for SEC14L4 Recombinant Protein (H00284904-P01)

View related products by pathway.

Blogs on SEC14L4

There are no specific blogs for SEC14L4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

SEC14L4 Antibody
NBP2-57764

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human SEC14L4 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol SEC14L4