SCP1 Recombinant Protein Antigen

Images

 
There are currently no images for SCP1 Recombinant Protein Antigen (NBP2-54674PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

SCP1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human SYCP1.

Source: E. coli

Amino Acid Sequence: TLGGDSTFFKSFNKCTEDDFEFPFAKTNLSKNGENIDSDPALQKVNFLPVLEQVGNSDCHYQEGLKDSDLENSEGLSRVYSKLYKEAEKIKKWKVSTEAELRQKESKLQENRKIIEAQRKAIQEL

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
SYCP1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-54674.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
32 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for SCP1 Recombinant Protein Antigen

  • Cancer/testis antigen 8
  • CT8MGC104417
  • HOM-TES-14
  • SCP1SCP-1
  • synaptonemal complex protein 1

Background

The synaptonemal complex is a multiprotein complex that mediates synapses during the zygotene stage and then disintegrates. Resulting from chromosome pairing interactions, the synaptonemal complex unites homologous chromosomes during the prophase stage of meiosis.

Synaptonemal complex protein 1 (SCP1) is a major component of the transverse filaments of synaptonemal complex. SCP1 is therefore critical to proper homologus chromosome pairing.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB300-232
Species: Bv, Ch, Fe, Hu, Mu, Pa, Po, Rt
Applications: IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NBP1-47714
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
AF4928
Species: Hu
Applications: CyTOF-ready, Flow, WB
NBP1-20903
Species: Hu
Applications: Flow, ICC/IF, PEP-ELISA
NBP3-35541
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NBP2-94045
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB
H00006757-M01
Species: Hu
Applications: ELISA, IHC, IHC-P, WB
NBP1-85958
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-67381
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, KO, WB
NBP1-32283
Species: Hu, Mu, Rt
Applications: WB
NBP2-49659
Species: Hu
Applications: IHC, IHC-P
NBP2-72110
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
NB100-598
Species: Hu
Applications: CyTOF-ready, Flow, ICC/IF, IP, WB
AF2288
Species: Hu
Applications: ICC, IHC, Simple Western, WB
NBP3-20167
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC, IP, WB
NBP1-58172
Species: Hu, Mu
Applications: WB
MAB1144
Species: Hu
Applications: CyTOF-ready, Flow, ICC, WB
NBP1-84366
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-34145
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-54674PEP
Species: Hu
Applications: AC

Publications for SCP1 Recombinant Protein Antigen (NBP2-54674PEP) (0)

There are no publications for SCP1 Recombinant Protein Antigen (NBP2-54674PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SCP1 Recombinant Protein Antigen (NBP2-54674PEP) (0)

There are no reviews for SCP1 Recombinant Protein Antigen (NBP2-54674PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for SCP1 Recombinant Protein Antigen (NBP2-54674PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional SCP1 Products

Array NBP2-54674PEP

Research Areas for SCP1 Recombinant Protein Antigen (NBP2-54674PEP)

Find related products by research area.

Blogs on SCP1.

Using SCP3/SYCP3 Antibodies as Meiosis Markers in Gametogenesis and DNA Repair Studies
The synaptonemal complex (SC) is a protein structure that forms during the synapsis of homologous chromosomes during meiosis. This structure is involved in the processes of chromosome synapsis, genetic recombination and subsequent chromosome segregati...  Read full blog post.

SCP1 a Potential Cancer Target for Immunotherapy
Synaptonemal Complex Protein 1 (SCP1) is a novel tumor antigen that belongs to the growing family of cancer/testis antigens (CTA). SCP-1 is known to be selectively expressed during the meiotic prophase of spermatocytes and is involved in the pairing o...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our SCP1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol SYCP1