SCML2 Antibody (1C8)

Images

 
Immunocytochemistry/ Immunofluorescence: SCML2 Antibody (1C8) [H00010389-M01] - Analysis of monoclonal antibody to SCML2 on HeLa cell . Antibody concentration 10 ug/ml.
Sandwich ELISA: SCML2 Antibody (1C8) [H00010389-M01] - Detection limit for recombinant GST tagged SCML2 is 0.3 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF
Clone
1C8
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

SCML2 Antibody (1C8) Summary

Immunogen
SCML2 (NP_006080, 251 a.a. ~ 350 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. AKTESSPSEASQHSMQSPQKTTLILPTQQVRRSSRIKPPGPTAVPKRSSSVKNITPRKKGPNSGKKEKPLPVICSTSAASLKSLTRDRGMLYKDVASGPC
Specificity
SCML2 (1C8)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
SCML2
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Immunocytochemistry/ Immunofluorescence
  • Sandwich ELISA
  • Western Blot 1:500
Application Notes
Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.

Reactivity Notes

Human. Other species not tested.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for SCML2 Antibody (1C8)

  • sex comb on midleg (Drosophila)-like 2
  • sex comb on midleg-like 2 (Drosophila)
  • sex comb on midleg-like protein 2

Background

SCML2 - sex comb on midleg-like 2 (Drosophila)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for SCML2 Antibody (H00010389-M01) (0)

There are no publications for SCML2 Antibody (H00010389-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SCML2 Antibody (H00010389-M01) (0)

There are no reviews for SCML2 Antibody (H00010389-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for SCML2 Antibody (H00010389-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SCML2 Antibody (1C8) and receive a gift card or discount.

Bioinformatics

Gene Symbol SCML2
Entrez
OMIM
Uniprot