Recombinant Human SCMH1 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human SCMH1 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 404-502 of Human SCMH1 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:EKLCHNLRSDNLFGNQPFTQTHLSLTAIEYSHSHDRYLPGETFVLGNSLARSLEPHSDSMDSASNPTNLVSTSQRHRPLLSSCGLPPSTASAVRRLCSR

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
SCMH1
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human SCMH1 Protein

  • polycomb protein SCMH1
  • Scml3
  • sex comb on midleg homolog 1 (Drosophila)
  • Sex comb on midleg homolog 1

Background

SCMH1 - sex comb on midleg homolog 1 (Drosophila)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-37371
Species: Hu
Applications: WB, ELISA, Flow, CyTOF-ready
NBP1-33748
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
H00051053-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
21650002
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NB100-2567
Species: Hu
Applications: WB, IHC-P, IP
NBP1-33581
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P
NBP1-91979
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB600-480
Species: Hu, Mu, Rt, Ca, Ch, Pm
Applications: WB, ELISA, IHC, IHC-P
NBP1-62667
Species: Hu
Applications: WB
H00006322-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
AF2067
Species: Hu, Po, Ca
Applications: WB, Flow, IHC, CyTOF-ready, ICC
AF4937
Species: Hu
Applications: WB, IHC
NB100-56346
Species: Hu, Mu
Applications: WB, ELISA, IHC-P
MAB21363
Species: Hu
Applications: WB, IHC, IP
NBP1-80271
Species: Hu, Mu
Applications: WB, IHC, IHC-P

Publications for SCMH1 Partial Recombinant Protein (H00022955-Q01) (0)

There are no publications for SCMH1 Partial Recombinant Protein (H00022955-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SCMH1 Partial Recombinant Protein (H00022955-Q01) (0)

There are no reviews for SCMH1 Partial Recombinant Protein (H00022955-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SCMH1 Partial Recombinant Protein (H00022955-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional SCMH1 Products

Bioinformatics Tool for SCMH1 Partial Recombinant Protein (H00022955-Q01)

Discover related pathways, diseases and genes to SCMH1 Partial Recombinant Protein (H00022955-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SCMH1 Partial Recombinant Protein (H00022955-Q01)

Discover more about diseases related to SCMH1 Partial Recombinant Protein (H00022955-Q01).
 

Pathways for SCMH1 Partial Recombinant Protein (H00022955-Q01)

View related products by pathway.

PTMs for SCMH1 Partial Recombinant Protein (H00022955-Q01)

Learn more about PTMs related to SCMH1 Partial Recombinant Protein (H00022955-Q01).

Blogs on SCMH1

There are no specific blogs for SCMH1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

p19ARF Antibody
NB200-106

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human SCMH1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol SCMH1