SCAMP5 Recombinant Protein Antigen Summary
| Description |
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human SCAMP5. Source: E. coli
Amino Acid Sequence: GSFSKAQEEWTTGAWKNPHVQQAAQNAAMGAAQGAMNQPQTQYSATPNYTYSNE Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)
This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions. |
| Source |
E. coli |
| Protein/Peptide Type |
Recombinant Protein Antigen |
| Gene |
SCAMP5 |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Applications/Dilutions
| Dilutions |
- Antibody Competition 10 - 100 molar excess
|
| Application Notes |
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-13284. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com |
| Theoretical MW |
23 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS and 1M Urea, pH 7.4. |
| Preservative |
No Preservative |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Alternate Names for SCAMP5 Recombinant Protein Antigen
Background
Secretory Carrier Membrane Proteins (SCAMPs) are proteins that are components of post Golgi membranes. These proteins are implicated to function in membrane trafficking. In fibroblasts, SCAMPs are concentrated in compartments that are involved in the recycling of cell surface receptors and endocytosis. In neurons, SCAMPs are associated with synaptic vesicles, secretion granules and transporter vesicles. SCAMPs are composed of four central transmembrane regions and a cytoplasmic tail. Of the five known SCAMPs, SCAMPs 1-3 contain cytoplasmic N-terminal regions with NPF repeats. NPF repeats are found to interact with EH domain proteins that function in budding of transport vesicles from the plasma membrane or the Golgi complex. SCAMPs 4 and 5 lack the N-terminal NPF repeats. SCAMPs 1-4 are all ubiquitously coexpressed while SCAMP 5 is only detectable in the brain. Studies show that SCAMP 5 is expressed late in development which is coincident with expansion of mature synapses.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: ELISA, IHC, WB
Species: Hu
Applications: ELISA
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: IHC, IHC-P, PEP-ELISA, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, S-ELISA, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: AC
Publications for SCAMP5 Protein (NBP2-13284PEP) (0)
There are no publications for SCAMP5 Protein (NBP2-13284PEP).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for SCAMP5 Protein (NBP2-13284PEP) (0)
There are no reviews for SCAMP5 Protein (NBP2-13284PEP).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
FAQs for SCAMP5 Protein (NBP2-13284PEP) (0)
Additional SCAMP5 Products
Research Areas for SCAMP5 Protein (NBP2-13284PEP)
Find related products by research area.
|
Blogs on SCAMP5