SCAF8/RBM16 Antibody - Azide and BSA Free

Western Blot: SCAF8/RBM16 Antibody - Azide and BSA Free [NBP3-15752] - Western blot analysis of extracts of HeLa cells, using SCAF8/RBM16 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit .Exposure time: 180s.

Western Blot: SCAF8/RBM16 Antibody - Azide and BSA Free [NBP3-15752] - Western blot analysis of extracts of various cell lines, using SCAF8/RBM16 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit .Exposure time: 30s.

• Reactivity: Hu, Mu, Rt
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: Azide and BSA Free

SCAF8/RBM16 Antibody - Azide and BSA Free Summary

• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 572-634 of human SCAF8/RBM16 (NP_055707.3). PWEKVKVDDLEGFAEGGMIDQETVNTEWETVKSSEPVKETVQTTQSPTPVEKETVVTTQAEVF
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SCAF8
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1:500 - 1:1000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.05% Proclin 300
• Purity: Affinity purified

Alternate Names for SCAF8/RBM16 Antibody - Azide and BSA Free

• CCAP7
• CDC5L complex-associated protein 7
• KIAA1116RNA-binding protein 16
• putative RNA-binding protein 16
• RBM16
• RNA binding motif protein 16
• RNA-binding motif protein 16
• SR-like CTD-associated factor 8
• SR-related and CTD-associated factor 8
• SR-related CTD-associated factor 8

Background

SCAF8/RBM16 (SR-related and CTD-associated factor 8) contains an RNA recognition motif found in a variety of RNA binding proteins that function in RNA processing. The function of SCAF8 is unknown.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SCAF8