SAP30L Recombinant Protein Antigen

Images

 
There are currently no images for SAP30L Recombinant Protein Antigen (NBP3-17535PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

SAP30L Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human SAP30L

Source: E. coli

Amino Acid Sequence: MNGFSTEEDSREGPPAAPAAAAPGYGQSCCLIE

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
SAP30L
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-17535.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
21 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for SAP30L Recombinant Protein Antigen

  • DKFZp667L2214
  • FLJ11526
  • FLJ36497
  • HCV non-structural protein 4A-transactivated protein 2
  • histone deacetylase complex subunit SAP30L
  • NS4ATP2FLJ23595
  • SAP30-like
  • Sin3 corepressor complex subunit SAP30L
  • Sin3A associated protein p30-like
  • Sin3-associated protein p30-like

Background

SAP30L is a novel TGF- beta up-regulated mRNA species, the Sin3-associated protein 30-like, SAP30L has been identified. The predicted nuclear localization signal of SAP30L is sufficient for nuclear transport of the protein although mutating it does not completely remove SAP30L from the nuclei. By reason of its nuclear localization and close homology to SAP30 it is thought that SAP30L might have a role in recruiting the Sin3-histone deacetylase complex to specific co-repressor complexes in response to TGF-beta, leading to the silencing of proliferation-driving genes in the differentiating intestinal epithelial cells.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00008819-M02
Species: Hu
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NB600-1263
Species: Hu, Mu, Rt
Applications: ChIP, Flow, ICC/IF, IHC,  IHC-P, IP, WB
NBP1-83908
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NB110-40773
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P
NBP1-82883
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP1-81008
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NB100-59787
Species: Hu, Mu
Applications: Flow, IB, ICC/IF, IHC,  IHC-P, IP, KD, PLA, WB
AF2444
Species: Hu
Applications: IHC, WB
NBP1-90909
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-88719
Species: Hu, Mu, Rt
Applications: ChIP-EXO-SEQ, ICC/IF, IHC,  IHC-P, WB
NBP2-41304
Species: Hu, Po, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NB100-53816
Species: Hu, Rt
Applications: IHC,  IHC-P, PEP-ELISA, WB

Publications for SAP30L Recombinant Protein Antigen (NBP3-17535PEP) (0)

There are no publications for SAP30L Recombinant Protein Antigen (NBP3-17535PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SAP30L Recombinant Protein Antigen (NBP3-17535PEP) (0)

There are no reviews for SAP30L Recombinant Protein Antigen (NBP3-17535PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for SAP30L Recombinant Protein Antigen (NBP3-17535PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional SAP30L Products

Blogs on SAP30L

There are no specific blogs for SAP30L, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our SAP30L Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol SAP30L