Home » RYR3 » RYR3 Proteins » RYR3 Recombinant Protein Antigen

RYR3 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for RYR3 Recombinant Protein Antigen (NBP2-76559PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

100% Guarantee on every product

RYR3 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human RYR3

Source: E.coli

Amino Acid Sequence: TMDSPPCLKVTHKTFGTQNSNADMIYCRLSMPVECHSSFSHSPCLDSEAFQKRKQMQEILSHTTTQCYYAIRIFAGQ
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
RYR3
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP2-76559. Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed. For further blocking peptide related protocol, click here.
Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for RYR3 Recombinant Protein Antigen

  • brain ryanodine receptor-calcium release channel
  • brain-type ryanodine receptor
  • HBRR
  • ryanodine receptor 3
  • RYR-3

Background

Ryanodine receptors, such as RYR3, are intracellular calcium ion release channels responsible for the release of Ca(2+) from intracellular stores following transduction of many different extracellular stimuli.(supplied by OMIM)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Ryanodine Receptor
Antibody (34C) - BSA ...
NB300-543
Immunohistochemistry-Paraffin: Ryanodine Receptor Antibody (34C) [NB300-543] - Biopsies of deparaffinized Human skeletal muscle tissue.
(12 Publications)
Species: Am, Bv, Ca, Ma, Fi, Hu, Ma-Mn, Mu, Pm, Rb, Rt, Sh
Applications: B/N, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Ryanodine Receptor
2 Antibody
NBP1-90091
Immunohistochemistry-Paraffin: Ryanodine Receptor 2 Antibody [NBP1-90091] - Analysis in human heart muscle and liver tissues. Corresponding RYR2 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: Ryanodine Receptor 2 Antibody [NBP1-90091] - Staining of human liver shows no positivity in hepatocytes as expected.
Immunohistochemistry-Paraffin: Ryanodine Receptor 2 Antibody [NBP1-90091] - Staining of human skeletal muscle shows no positivity in myocytes as expected.
(1 Publication)
Species: Hu, Mu
Applications: ICC/IF, IHC-FrFl, IHC, IHC-P
gamma-Synuclein
Antibody
NBP1-89996
Western Blot: gamma-Synuclein Antibody [NBP1-89996] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4
Immunohistochemistry-Paraffin: gamma-Synuclein Antibody [NBP1-89996] - Staining of human cerebellum shows strong cytoplasmic positivity in Purkinje cells.
Immunohistochemistry: gamma-Synuclein Antibody [NBP1-89996] - Staining of human adrenal gland shows high expression.
Species: Hu
Applications: IHC, IHC-P, WB
Secretin R Antibody
AF6387
Western blot shows lysates of human brain (cerebellum) tissue. PVDF Membrane was probed with 1 µg/mL of Human Secretin R Antigen Affinity-purified Polyclonal Antibody (Catalog # AF6387) followed by HRP-conjugated Anti-Sheep IgG Secondary Antibody (Catalog # HAF016). A specific band was detected for Secretin R delta 3/4 at approximately 50 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 8.
Species: Hu
Applications: WB
Gremlin 1
[Unconjugated]
5190-GR
1 µg/lane of Recombinant Human Gremlin was resolved with SDS-PAGE under reducing (R) conditions and visualized by silver staining, showing major bands at 25‑30 kDa. Multiple bands in gel are due to variable glycosylation.
Recombinant Human Gremlin (Catalog # 5190‑GR) inhibits BMP-4-induced alkaline phosphatase production in the MC3T3-E1 mouse preosteoblast cell line. The ED50 for this effect is 0.025‑0.15 µg/mL in the presence of 30 ng/mL of Recombinant Human BMP-4 (Catalog # 314‑BP).
(17 Publications)
Species: Hu
Applications: BA
IP3R1 Antibody
NBP1-21398
Immunohistochemistry-Paraffin: IP3R1 Antibody [NBP1-21398] - Section of mouse cerebellum. Antibody: Affinity purified rabbit anti- IP3R1 used at a dilution of 1:100 (2ug/ml). Detection: Red-fluorescent Goat anti-Rabbit IgG-heavy and light chain cross-adsorbed Antibody DyLight 594 Conjugated used ata dilution of 1:100. Counterstain: DAPI (blue).
Western Blot: IP3R1 Antibody [NBP1-21398] - Whole cell lysate from HeLa cells. Affinity purified rabbit anti-IP3R1 antibody. IP3R1 was also immunoprecipitated by rabbit anti-IP3R1 antibody NBP1-21397.
Immunohistochemistry-Paraffin: IP3R1 Antibody [NBP1-21398] - Section of mouse cerebellum. Antibody: Affinity purified rabbit anti- IP3R1 used at a dilution of 1:200 (1ug/ml). Detection: DAB. Counterstain: IHC Hematoxylin (blue).
(1 Review)
(2 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
FMN1 Antibody (4F4)
H00342184-M07
ELISA: FMN1 Antibody (4F4) [H00342184-M07] - Detection limit for recombinant GST tagged FMN1 is 3 ng/ml as a capture antibody.
Immunocytochemistry/Immunofluorescence: FMN1 Antibody (4F4) [H00342184-M07] - Analysis of monoclonal antibody to FMN1 on HeLa cell. Antibody concentration 10 ug/ml
Western Blot: FMN1 Antibody (4F4) [H00342184-M07] - Analysis of FMN1 expression in human colon.
Species: Hu
Applications: ELISA, ICC/IF, WB
Calmodulin 2
Antibody
NBP2-14871
Immunocytochemistry/Immunofluorescence: Calmodulin 2 Antibody [NBP2-14871] - DIV9 rat E18 primary cortical neuron cells were fixed in 4% paraformaldehyde at RT for 15 min. Green: Calmodulin 2 stained by Calmodulin 2 antibody diluted at 1:500.Red: beta Tubulin 3/ Tuj1, stained by beta Tubulin 3/ Tuj1 antibody [1338] diluted at 1:500. Blue: Fluoroshield with DAPI.
Western Blot: Calmodulin 2 Antibody [NBP2-14871] - Various tissue extracts (50 ug) were separated by 15% SDS-PAGE, and the membrane was blotted with Calmodulin antibody diluted at 1:1000. The HRP-conjugated anti-rabbit IgG antibody (NBP2-19301) was used to detect the primary antibody.
(1 Publication)
Species: Mu, Rt
Applications: ICC/IF, WB
Calmodulin
Antibody (2D1) - BSA
NB120-2860
Immunocytochemistry/Immunofluorescence: Calmodulin Antibody (2D1) [NB120-2860] - Calmodulin staining (green), F-Actin staining with Phalloidin (red) and nuclei with DAPI (blue) is shown.A2058 melanoma cells were grown on chamber slides and fixed with formaldehyde prior to staining. Cells were probed without (control) or with or an antibody recognizing Calmodulin at a dilution of 1:20 over night at 4C, washed with PBS and incubated with a DyLight-488 conjugated.
Immunocytochemistry/Immunofluorescence: Calmodulin Antibody (2D1) [NB120-2860] - Calmodulin staining (green), F-Actin staining with Phalloidin (red) and nuclei with DAPI (blue) is shown. C6 glioma cells were grown on chamber slides and fixed with formaldehyde prior to staining. Cells were probed without (control) or with or an antibody recognizing Calmodulin at a dilution of 1:20 over night at 4C, washed with PBS and incubated with a DyLight-488 conjugated.
Immunocytochemistry/Immunofluorescence: Calmodulin Antibody (2D1) [NB120-2860] - Calmodulin staining (green), F-Actin staining with Phalloidin (red) and nuclei with DAPI (blue) is shown. HeLa Cells were grown on chamber slides and fixed with formaldehyde prior to staining. Cells were probed without (control) or with or an antibody recognizing Calmodulin at a dilution of 1:20 over night at 4C, washed with PBS and incubated with a DyLight-488 conjugated.
(2 Publications)
Species: Ba, Bv, Ch, Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Calmodulin 3
Antibody
NBP2-15669
Western Blot: Calmodulin 3 Antibody [NBP2-15669] - Upregulation of miRNA inhibits the expression level of target genes in HK-2 cells and CKD patients. Western Blot shows that hsa-miR-4709-3p inhibit the protein level of ITGB8 and CALM3 respectively. NC: scrambled negative control transfection;4709: hsa-miR-4709-3p transfection. Image collected and cropped by CiteAb from the following publication (https://bmcnephrol.biomedcentral.com/articles/10.1186/s12882-019-1512-x) licensed under a CC-BY licence.
Western Blot: Calmodulin 3 Antibody [NBP2-15669] - Sample (50 ug of whole cell lysate) A: Mouse Brain, 15% SDS PAGE gel, diluted at 1:1000.
(1 Publication)
Species: Hu, Mu, Rt
Applications: IHC, WB
IP3R3 Antibody
NBP1-21399
Immunohistochemistry-Paraffin: IP3R3 Antibody [NBP1-21399] - Section of human stomach carcinoma. Antibody: Affinity purified rabbit anti-IP3R3 used at a dilution of 1:1,000 (1ug/ml). Detection: DAB
Immunoprecipitation: IP3R3 Antibody [NBP1-21399] - Whole cell lysate (1 mg for IP, 20% of IP loaded) from HeLa cells. Affinity purified rabbit anti-IP3R3 antibody used for IP at 3 mcg/mg lysate. IP3R3 was also immunoprecipitated by rabbit anti-IP3R3 antibody NBP1-21400 which recognizes a downstream e
(1 Publication)
Species: Hu
Applications: IHC, IHC-P, IP, WB (-)
CACNA1S Antibody
(1A) - BSA Free
NB300-542
Flow Cytometry: CACNA1S Antibody (1A) [NB300-542] - Flow cytometry analysis of Dihydropyridine Receptor alpha-1 in U251 cells (green) compared to an isotype control (blue). Cells were harvested, adjusted to a concentration of 1-5x10^6 cells/ml, fixed with 2% paraformaldehyde and washed with PBS.
Immunohistochemistry-Paraffin: CACNA1S Antibody (1A) [NB300-542] - Immunohistochemistry was performed on normal biopsies of deparaffinized human skeletal muscle tissue.
(2 Publications)
Species: Gp, Hu, Mu, Rb, Rt
Applications: Flow, IHC, IHC-Fr, IHC-P, IP, WB
Mouse CD3+ T Cell,
Small Column Enrichme ...
MTCC-10-NOV
Mouse CD3+ T Cell, Small Column Enrichment Kit
Species: Mu
FKBP12.6 Antibody
[Unconjugated]
AF4174
Western blot shows lysates of human cortex, human hippocampus, and mouse brain tissues. PVDF membrane was probed with 1 µg/mL of Human/Mouse/Rat FKBP12.6 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF4174) followed by HRP‑conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). A specific band was detected for FKBP12.6 at approximately 13 kDa (as indicated). This experiment was conducted using Immunoblot Buffer Group 2.
Simple Western lane view shows lysates of human brain (cortex) tissue and mouse brain (cortex) tissue, loaded at 0.2 mg/mL. A specific band was detected for FKBP12.6 at approximately 16 kDa (as indicated) using 50 µg/mL of Goat Anti-Human/Mouse/Rat FKBP12.6 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF4174) followed by 1:50 dilution of HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). This experiment was conducted under reducing conditions and using the12-230 kDa separation system.
FKBP12.6 was detected in immersion fixed paraffin-embedded sections of human brain (caudate nucleus) using Goat Anti-Human/Mouse/Rat FKBP12.6 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF4174) at 10 µg/mL for 1 hour at room temperature followed by incubation with the Anti-Goat IgG VisUCyte™ HRP Polymer Antibody (Catalog # VC004). Tissue was stained using DAB (brown) and counterstained with hematoxylin (blue). Specific staining was localized to cytoplasm in neurons. View our protocol for IHC Staining with VisUCyte HRP Polymer Detection Reagents.
(3 Publications)
Species: Hu, Mu, Rt
Applications: IHC, Simple Western, WB
DIO2 Antibody
NBP1-00178
Flow Cytometry: DIO2 Antibody [NBP1-00178] - Analysis of paraformaldehyde fixed MCF7 cells (blue line), permeabilized with 0.5%Triton. Primary incubation 1hr (10ug/ml) followed by Alexa Fluor 488 secondary antibody (1ug/ml). IgG control: Unimmunized goat IgG (black line) followed by Alexa Fluor 488 secondary antibody
Immunocytochemistry/Immunofluorescence: DIO2 Antibody [NBP1-00178] - Analysis of paraformaldehyde fixed HeLa cells, permeabilized with 0.15% Triton.Primary incubation 1hr (10ug/ml) followed by Alexa Fluor 488 secondary antibody (2ug/ml), showing nuclear and cytoplasmic staining. The nuclear stain is DAPI (blue). Negative control: Unimmunized goat IgG (10ug/ml) followed by Alexa Fluor 488 secondary antibody (2ug/ml).
Immunohistochemistry-Frozen: DIO2 Antibody [NBP1-00178] - IHC analysis of DIO2 in cryo-sectioned Mouse Hippocampus using NBP1-00178 at 2ug/ml. Microwaved antigen retrieval with citrate buffer pH 4.5, HRP-staining.
(7 Publications)
Species: Hu, Mu, Sh
Applications: Flow, ICC/IF, IHC, IHC-Fr, PEP-ELISA, WB
Dystrophin Antibody
NBP1-89953
Immunohistochemistry-Paraffin: Dystrophin Antibody [NBP1-89953] - Staining of human heart muscle shows strong membranous positivity in myocytes.
Immunohistochemistry-Paraffin: Dystrophin Antibody [NBP1-89953] - Staining of human skeletal muscle shows strong membranous positivity in myocytes.
Immunohistochemistry-Paraffin: Dystrophin Antibody [NBP1-89953] - Staining of human tonsil shows no positivity as expected.
(4 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P

Publications for RYR3 Recombinant Protein Antigen (NBP2-76559PEP) (0)

There are no publications for RYR3 Recombinant Protein Antigen (NBP2-76559PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RYR3 Recombinant Protein Antigen (NBP2-76559PEP) (0)

There are no reviews for RYR3 Recombinant Protein Antigen (NBP2-76559PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for RYR3 Recombinant Protein Antigen (NBP2-76559PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional RYR3 Products

Array NBP2-76559PEP

Bioinformatics Tool for RYR3 Recombinant Protein Antigen (NBP2-76559PEP)

Discover related pathways, diseases and genes to RYR3 Recombinant Protein Antigen (NBP2-76559PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RYR3 Recombinant Protein Antigen (NBP2-76559PEP)

Discover more about diseases related to RYR3 Recombinant Protein Antigen (NBP2-76559PEP).
 

Pathways for RYR3 Recombinant Protein Antigen (NBP2-76559PEP)

View related products by pathway.

PTMs for RYR3 Recombinant Protein Antigen (NBP2-76559PEP)

Learn more about PTMs related to RYR3 Recombinant Protein Antigen (NBP2-76559PEP).

Blogs on RYR3

There are no specific blogs for RYR3, but you can read our latest blog posts.

Contact Information

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our RYR3 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol RYR3