RYR3 Recombinant Protein Antigen

Images

 
There are currently no images for RYR3 Recombinant Protein Antigen (NBP2-76559PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

RYR3 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human RYR3

Source: E.coli

Amino Acid Sequence: TMDSPPCLKVTHKTFGTQNSNADMIYCRLSMPVECHSSFSHSPCLDSEAFQKRKQMQEILSHTTTQCYYAIRIFAGQ

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
RYR3
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP2-76559. Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed. For further blocking peptide related protocol, click here.
Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for RYR3 Recombinant Protein Antigen

  • brain ryanodine receptor-calcium release channel
  • brain-type ryanodine receptor
  • HBRR
  • ryanodine receptor 3
  • RYR-3

Background

Ryanodine receptors, such as RYR3, are intracellular calcium ion release channels responsible for the release of Ca(2+) from intracellular stores following transduction of many different extracellular stimuli.(supplied by OMIM)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB300-543
Species: Am, Bv, Ca, Ma, Fi, Hu, Ma-Mn, Mu, Pm, Rb, Rt, Sh
Applications: B/N, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NBP1-90091
Species: Hu, Mu
Applications: ICC/IF, IHC-FrFl, IHC, IHC-P
NBP1-89996
Species: Hu
Applications: IHC, IHC-P, WB
AF6387
Species: Hu
Applications: WB
5190-GR
Species: Hu
Applications: BA
NBP1-21398
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
H00342184-M07
Species: Hu
Applications: ELISA, ICC/IF, WB
NBP2-14871
Species: Mu, Rt
Applications: ICC/IF, WB
NB120-2860
Species: Ba, Bv, Ch, Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
NBP2-15669
Species: Hu, Mu, Rt
Applications: IHC, WB
NBP1-21399
Species: Hu
Applications: IHC, IHC-P, IP, WB (-)
NB300-542
Species: Gp, Hu, Mu, Rb, Rt
Applications: Flow, IHC, IHC-Fr, IHC-P, IP, WB
AF4174
Species: Hu, Mu, Rt
Applications: IHC, Simple Western, WB
NBP1-00178
Species: Hu, Mu, Sh
Applications: Flow, ICC/IF, IHC, IHC-Fr, PEP-ELISA, WB
NBP1-89953
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P

Publications for RYR3 Recombinant Protein Antigen (NBP2-76559PEP) (0)

There are no publications for RYR3 Recombinant Protein Antigen (NBP2-76559PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RYR3 Recombinant Protein Antigen (NBP2-76559PEP) (0)

There are no reviews for RYR3 Recombinant Protein Antigen (NBP2-76559PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for RYR3 Recombinant Protein Antigen (NBP2-76559PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional RYR3 Products

Array NBP2-76559PEP

Bioinformatics Tool for RYR3 Recombinant Protein Antigen (NBP2-76559PEP)

Discover related pathways, diseases and genes to RYR3 Recombinant Protein Antigen (NBP2-76559PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RYR3 Recombinant Protein Antigen (NBP2-76559PEP)

Discover more about diseases related to RYR3 Recombinant Protein Antigen (NBP2-76559PEP).
 

Pathways for RYR3 Recombinant Protein Antigen (NBP2-76559PEP)

View related products by pathway.

PTMs for RYR3 Recombinant Protein Antigen (NBP2-76559PEP)

Learn more about PTMs related to RYR3 Recombinant Protein Antigen (NBP2-76559PEP).

Blogs on RYR3

There are no specific blogs for RYR3, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our RYR3 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol RYR3