RSPH9 Antibody

Images

 
Immunohistochemistry-Paraffin: RSPH9 Antibody [NBP1-86750] - Staining of human fallopian tube shows strong positivity in cilia of glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

RSPH9 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:SSVVKGRFMGDPSYEYEHTELQKVNEGEKVFEEEIVVQIKEETRLVSVIDQIDKAVAIIPRGALFKTPFGPTHVNRTFEGLSLSEAKKLSSY
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RSPH9
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
RSPH9 Protein (NBP1-86750PEP)
Publications
Read Publications using NBP1-86750.

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (89%), Rat (87%). Reactivity reported in scientific literature (PMID: 23213475)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for RSPH9 Antibody

  • C6orf206
  • chromosome 6 open reading frame 206
  • CILD12
  • FLJ30845
  • mitochondrial ribosomal protein S18A-like 1
  • MRPS18AL1
  • radial spoke head 9 homolog (Chlamydomonas)
  • radial spoke head protein 9 homolog

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-90572
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB25031
Species: Hu
Applications: WB, IHC, IP
NBP1-89840
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-86750
Species: Hu
Applications: IHC, IHC-P

Publications for RSPH9 Antibody (NBP1-86750)(2)

Reviews for RSPH9 Antibody (NBP1-86750) (0)

There are no reviews for RSPH9 Antibody (NBP1-86750). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for RSPH9 Antibody (NBP1-86750) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RSPH9 Products

Bioinformatics Tool for RSPH9 Antibody (NBP1-86750)

Discover related pathways, diseases and genes to RSPH9 Antibody (NBP1-86750). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RSPH9 Antibody (NBP1-86750)

Discover more about diseases related to RSPH9 Antibody (NBP1-86750).
 

Pathways for RSPH9 Antibody (NBP1-86750)

View related products by pathway.

Blogs on RSPH9

There are no specific blogs for RSPH9, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RSPH9 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RSPH9