RSPH9 Antibody - BSA Free

Immunohistochemistry-Paraffin: RSPH9 Antibody [NBP1-86750] - Staining in human fallopian tube and pancreas tissues.. Corresponding RSPH9 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: RSPH9 Antibody [NBP1-86750] - Staining of human fallopian tube shows strong membranous positivity in glandular cells.

Immunohistochemistry-Paraffin: RSPH9 Antibody [NBP1-86750] - Staining of human pancreas shows no positivity in exocrine glandular cells.

Immunohistochemistry-Paraffin: RSPH9 Antibody [NBP1-86750] - Staining of human testis shows weak to moderate cytoplasmic positivity in cells in seminiferous ducts.

Immunohistochemistry-Paraffin: RSPH9 Antibody [NBP1-86750] - Staining of human liver shows no positivity in hepatocytes as expected.

• Reactivity: Hu
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

RSPH9 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit RSPH9 Antibody - BSA Free (NBP1-86750) is a polyclonal antibody validated for use in IHC and ICC/IF. Anti-RSPH9 Antibody: Cited in 3 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: SSVVKGRFMGDPSYEYEHTELQKVNEGEKVFEEEIVVQIKEETRLVSVIDQIDKAVAIIPRGALFKTPFGPTHVNRTFEGLSLSEAKKLSSY
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: RSPH9
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence Reported in scientific literature (PMID:34573882).
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  RSPH9 Protein (NBP1-86750PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (89%), Rat (87%).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for RSPH9 Antibody - BSA Free

• C6orf206
• chromosome 6 open reading frame 206
• CILD12
• FLJ30845
• mitochondrial ribosomal protein S18A-like 1
• MRPS18AL1
• radial spoke head 9 homolog (Chlamydomonas)
• radial spoke head protein 9 homolog

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for RSPH9 Antibody (NBP1-86750)(3)

Publications using NBP1-86750

• MUller L, Savas S, Tschanz S Et al. A Comprehensive Approach for the Diagnosis of Primary Ciliary DyskinesiaExperiences from the First 100 Patients of the PCD-UNIBE Diagnostic Center Diagnostics 2021-08-25 [PMID: 34573882] (ICC/IF, Human)
• Onoufriadis A, Shoemark A, Schmidts M et al. Targeted NGS gene panel identifies mutations in RSPH1 causing primary ciliary dyskinesia and a common mechanism for ciliary central pair agenesis due to radial spoke defects. Hum Mol Genet 2014-07-01 [PMID: 24518672]
• Narita K, Kozuka-Hata H, Nonami Y et al. Proteomic analysis of multiple primary cilia reveals a novel mode of ciliary development in mammals. Biol Open 2012-08-15 [PMID: 23213475]

Bioinformatics

• Gene Symbol: RSPH9