RSPH4A Antibody


Immunocytochemistry/ Immunofluorescence: RSPH4A Antibody [NBP1-90573] - Staining of human cell line A-431 shows localization to nucleus.
Immunohistochemistry-Paraffin: RSPH4A Antibody [NBP1-90573] - Staining in human fallopian tube and liver tissues using anti-RSPH4A antibody. Corresponding RSPH4A RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: RSPH4A Antibody [NBP1-90573] - Staining of human bronchus shows strong cytoplasmic and membranous positivity in respiratory epithelial cells.
Immunohistochemistry-Paraffin: RSPH4A Antibody [NBP1-90573] - Staining of human fallopian tube shows high expression.
Immunohistochemistry-Paraffin: RSPH4A Antibody [NBP1-90573] - Staining of human liver shows low expression as expected.

Product Details

Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P

Order Details

RSPH4A Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: RPWEGKTAASPQYSEPESSEPLEAKQGPETGRQSRSSRPWSPQSRAKTPLGGPAGPETSSPAPVSPREPSSSP
Specificity of human RSPH4A antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
RSPH4A Protein (NBP1-90573PEP)
Read Publication using NBP1-90573.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 24518672)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for RSPH4A Antibody

  • MGC126303
  • radial spoke head 4 homolog A (Chlamydomonas)
  • radial spokehead-like 3


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P

Publications for RSPH4A Antibody (NBP1-90573)(1)

Reviews for RSPH4A Antibody (NBP1-90573) (0)

There are no reviews for RSPH4A Antibody (NBP1-90573). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for RSPH4A Antibody (NBP1-90573) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional RSPH4A Products

Bioinformatics Tool for RSPH4A Antibody (NBP1-90573)

Discover related pathways, diseases and genes to RSPH4A Antibody (NBP1-90573). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RSPH4A Antibody (NBP1-90573)

Discover more about diseases related to RSPH4A Antibody (NBP1-90573).

Pathways for RSPH4A Antibody (NBP1-90573)

View related products by pathway.

Blogs on RSPH4A

There are no specific blogs for RSPH4A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our RSPH4A Antibody and receive a gift card or discount.


Gene Symbol RSPH4A