RPS23 Antibody (1E3.)

Images

 
Western Blot: RPS23 Antibody (1E3) [H00006228-M02] - RPS23 monoclonal antibody (M02), clone 1E3. Analysis of RPS23 expression in Raw 264.7.
Immunocytochemistry/ Immunofluorescence: RPS23 Antibody (1E3) [H00006228-M02] - Analysis of monoclonal antibody to RPS23 on HeLa cell. Antibody concentration 10 ug/ml.
Western Blot: RPS23 Antibody (1E3) [H00006228-M02] - RPS23 monoclonal antibody (M02), clone 1E3 Analysis of RPS23 expression in HeLa.
Western Blot: RPS23 Antibody (1E3) [H00006228-M02] - RPS23 monoclonal antibody (M02), clone 1E3. Analysis of RPS23 expression in PC-12.
Western Blot: RPS23 Antibody (1E3) [H00006228-M02] - RPS23 monoclonal antibody (M02), clone 1E3. Analysis of RPS23 expression in NIH/3T3.
Sandwich ELISA: RPS23 Antibody (1E3) [H00006228-M02] - Detection limit for recombinant GST tagged RPS23 is approximately 0.3ng/ml as a capture antibody.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ELISA, ICC/IF
Clone
1E3.
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

RPS23 Antibody (1E3.) Summary

Immunogen
RPS23 (NP_001016, 44 a.a. - 143 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. ASHAKGIVLEKVGVEAKQPNSAIRKCVRVQLIKNGKKITAFVPNDGCLNFIEENDEVLVAGFGRKGHAVGDIPGVRFKVVKVANVSLLALYKGKKERPRS
Specificity
RPS23 (1E3)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
RPS23
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IF and ELISA.

Reactivity Notes

Please note that this antibody is reactive to Mouse and derived from the same host, Mouse. Additional Mouse on Mouse blocking steps may be required for IHC and ICC experiments. Please contact Technical Support for more information.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for RPS23 Antibody (1E3.)

  • FLJ35016
  • homolog of yeast ribosomal protein S28
  • ribosomal protein S23,40S ribosomal protein S23

Background

Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal protein that is a component of the 40S subunit. The protein belongs to the S12P family of ribosomal proteins. It is located in the cytoplasm. The protein shares significant amino acid similarity with S. cerevisiae ribosomal protein S28. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-92352
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-1595
Species: Hu, Mu
Applications: WB, IHC-P, IP
NBP1-80803
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-33691
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-87799
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-01808
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, Flow
H00006201-M03
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC-P
NBP1-87797
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-20228
Species: Hu, Ze
Applications: WB
NBP1-43435
Species: Hu, Mu
Applications: WB, Flow
NBP2-37620
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC
H00006223-M01
Species: Hu
Applications: WB, ELISA
NB100-345
Species: Hu
Applications: WB, ChIP, IP
NBP1-80959
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00006192-P01
Species: Hu
NBP1-82761
Species: Hu
Applications: IHC, IHC-P
NB100-1103
Species: Hu
Applications: WB, PEP-ELISA
NBP2-22298
Species: Hu, Mu
Applications: IP (-), WB, IHC-P
NBP1-80804
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-25162
Species: Hu, Mu, Rt
Applications: WB, ICC/IF

Publications for RPS23 Antibody (H00006228-M02) (0)

There are no publications for RPS23 Antibody (H00006228-M02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RPS23 Antibody (H00006228-M02) (0)

There are no reviews for RPS23 Antibody (H00006228-M02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for RPS23 Antibody (H00006228-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RPS23 Products

Bioinformatics Tool for RPS23 Antibody (H00006228-M02)

Discover related pathways, diseases and genes to RPS23 Antibody (H00006228-M02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RPS23 Antibody (H00006228-M02)

Discover more about diseases related to RPS23 Antibody (H00006228-M02).
 

Pathways for RPS23 Antibody (H00006228-M02)

View related products by pathway.

PTMs for RPS23 Antibody (H00006228-M02)

Learn more about PTMs related to RPS23 Antibody (H00006228-M02).
 

Research Areas for RPS23 Antibody (H00006228-M02)

Find related products by research area.

Blogs on RPS23

There are no specific blogs for RPS23, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RPS23 Antibody (1E3.) and receive a gift card or discount.

Bioinformatics

Gene Symbol RPS23
Entrez
OMIM
Uniprot