RPL3L Antibody

Immunohistochemistry-Paraffin: RPL3L Antibody [NBP2-13257] - Analysis in human skeletal muscle and prostate tissues using NBP2-13257 antibody. Corresponding RPL3L RNA-seq data are presented for the same tissues.

Immunocytochemistry/Immunofluorescence: RPL3L Antibody [NBP2-13257] - Staining of human cell line PC-3 shows localization to nuclear speckles.

Immunohistochemistry-Paraffin: RPL3L Antibody [NBP2-13257] - Staining of human cerebral cortex shows no cytoplasmic positivity in neurons as expected.

Immunohistochemistry-Paraffin: RPL3L Antibody [NBP2-13257] - Staining of human prostate shows low expression as expected.

Immunohistochemistry-Paraffin: RPL3L Antibody [NBP2-13257] - Staining of human skeletal muscle shows moderate cytoplasmic positivity in myocytes.

Immunohistochemistry-Paraffin: RPL3L Antibody [NBP2-13257] - Staining of human prostate shows no cytoplasmic positivity in glandular cells as expected.

Immunohistochemistry-Paraffin: RPL3L Antibody [NBP2-13257] - Staining of human liver shows no cytoplasmic positivity in hepatocytes as expected.

• Reactivity: Hu
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

RPL3L Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: GHGRFQTAQEKRAFMGPQKKHLEKETPETSGDL
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: RPL3L
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF,Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  RPL3L Protein (NBP2-13257PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (85%), Rat (88%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for RPL3L Antibody

• 60S ribosomal protein L3-like
• ribosomal protein L3-like

Background

The RPL3L gene encodes a protein that shares sequence similarity with ribosomal protein L3. The protein belongs to the L3P family of ribosomal proteins. Unlike the ubiquitous expression of ribosomal protein genes, this gene has a tissue-specific pattern of exp

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: RPL3L