RPL3L Antibody


Immunocytochemistry/ Immunofluorescence: RPL3L Antibody [NBP2-13257] - Staining of human cell line PC-3 shows localization to nuclear speckles.
Immunohistochemistry-Paraffin: RPL3L Antibody [NBP2-13257] - Staining in human skeletal muscle and prostate tissues using anti-RPL3L antibody. Corresponding RPL3L RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: RPL3L Antibody [NBP2-13257] - Staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.
Immunohistochemistry-Paraffin: RPL3L Antibody [NBP2-13257] - Staining of human prostate shows low expression as expected.
Immunohistochemistry-Paraffin: RPL3L Antibody [NBP2-13257] - Staining of human skeletal muscle shows high expression.

Product Details

Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P

Order Details

RPL3L Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: GHGRFQTAQEKRAFMGPQKKHLEKETPETSGDL
Specificity of human RPL3L antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
RPL3L Protein (NBP2-13257PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (85%), Rat (88%)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for RPL3L Antibody

  • 60S ribosomal protein L3-like
  • ribosomal protein L3-like


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC
Species: Hu, Mu
Applications: WB, IHC, ICC
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for RPL3L Antibody (NBP2-13257) (0)

There are no publications for RPL3L Antibody (NBP2-13257).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RPL3L Antibody (NBP2-13257) (0)

There are no reviews for RPL3L Antibody (NBP2-13257). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for RPL3L Antibody (NBP2-13257) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional RPL3L Products

Bioinformatics Tool for RPL3L Antibody (NBP2-13257)

Discover related pathways, diseases and genes to RPL3L Antibody (NBP2-13257). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RPL3L Antibody (NBP2-13257)

Discover more about diseases related to RPL3L Antibody (NBP2-13257).

Blogs on RPL3L

There are no specific blogs for RPL3L, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our RPL3L Antibody and receive a gift card or discount.


Gene Symbol RPL3L