RPL10 Recombinant Protein Antigen

Images

 
There are currently no images for RPL10 Protein (NBP1-84037PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

RPL10 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human RPL10.

Source: E. coli

Amino Acid Sequence: KMSSCAGADRLQTGMRGAFGKPQGTVARVHIGQVIMSIRTKLQNKEHVIEALRRAKFKFPGRQKIHISKKWGFTKFNADEFEDMVAEKRLIPDGCGVKYIPSRGPLDKWW

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
RPL10
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-84037.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
30 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for RPL10 Recombinant Protein Antigen

  • 60S ribosomal protein L10
  • DXS648EFLJ27072
  • DXS648FLJ23544
  • Laminin receptor homolog
  • NOV
  • Protein QM
  • QMDKFZp686J1851
  • ribosomal protein L10
  • Tumor suppressor QM
  • Wilms tumor-related protein

Background

The c-Jun protein is a major component of the transcription factor AP-1, originally shown to mediate phorbol ester tumor promoter (TPA)-induced expression of responsive genes through the TPA-response element (TRE). The Jun proteins form homo- and heterodimers which bind the TRE, while Fos proteins are active only as heterodimers with any of the Jun proteins. Fos/Jun heterodimers have a much higher affinity for the TRE than Jun homodimers. A distant member of the MAP kinase family, designated c-Jun NH2-terminal kinase (JNK1) functions to regulate c-Jun by phosphorylation at the amino terminal serine regulatory sites, Ser 63 and Ser 73). QM has been described as a transcription factor that can function to bind DNA directly or alternatively can interact with c-Jun to inhibit transactivation of AP-1 promoter driven reporter vectors by Jun-Jun homodimers. QM is highly conserved throughout eukaryotic evolution and is apparently a member of a multi-gene family.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF3398
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
NBP1-88927
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-89396
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-41266
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP2-20211
Species: Hu, Mu
Applications: IHC,  IHC-P, WB
H00028299-P01
Species: Hu
Applications: ELISA, AP, PA, WB
H00026156-B01P
Species: Hu
Applications: ICC/IF, WB
NBP1-77397
Species: Hu, Mu
Applications: Flow, IB, ICC/IF, IHC,  IHC-P, KD, Simple Western, WB
NBP1-33518
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, IP, KD, KO, WB
NB100-2269
Species: Hu, Mu
Applications: IHC,  IHC-P, IP, KD, WB
NBP3-05567
Species: Hu, Mu
Applications: ICC/IF, WB
NBP2-20210
Species: Hu, I, Mu, Ze
Applications: IHC-WhMt, IHC,  IHC-P, WB
NB100-148
Species: Ch, Hu, Mu, Rt
Applications: ChIP, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, In vitro, KD, PLA, WB
NBP2-94035
Species: Hu, Mu, Rt
Applications: ChIP, ELISA, ICC/IF, IHC,  IHC-P, WB
NBP1-88445
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-00178
Species: Hu, Mu, Sh
Applications: Flow, ICC/IF, IHC, IHC-Fr, PEP-ELISA, WB
NBP2-07996
Species: Hu
Applications: WB
NBP1-84037PEP
Species: Hu
Applications: AC

Publications for RPL10 Protein (NBP1-84037PEP) (0)

There are no publications for RPL10 Protein (NBP1-84037PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RPL10 Protein (NBP1-84037PEP) (0)

There are no reviews for RPL10 Protein (NBP1-84037PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for RPL10 Protein (NBP1-84037PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional RPL10 Products

Blogs on RPL10

There are no specific blogs for RPL10, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our RPL10 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol RPL10