RNF212 Antibody - BSA Free Summary
| Immunogen |
This antibody was developed against a recombinant protein corresponding to amino acids: KLLEFIKHVCYHRHQSHRPCAPGWFCQVLQRPGAVSGEKTQQTRPAPPATCLLCLSCLSGFRHGPWRSQALPSDLVAPLFVSYTVEVSITNAGWS |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
RNF212 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunohistochemistry 1:20 - 1:50
- Immunohistochemistry-Paraffin 1:20 - 1:50
|
| Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Control Peptide |
|
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for RNF212 Antibody - BSA Free
Background
RNF212, also known as Probable E3 SUMO-protein ligase RNF212, has 6 isoforms, a 297 amino acid isoform that is 33 kDa, a 123 amino acid isoform that is 14 kDa, a 192 amino acid isoform that is 22 kDa, a 280 amino acid isoform that is 31 kDa, a 232 amino acid isoform that is 26 kDa, and a 273 amino acid isoform that is 30 kDa. This protein may function as a ubiquitin ligase and may be involved in meiotic recombination, regulates crossing-over during meiosis: required to couple chromosome synapsis to the formation of crossover-specific recombination complexes, localizes to recombination sites and stabilizes meiosis-specific recombination factors, may act as a SUMO E3 ligase that mediates sumoylation of target proteins MSH4 and/or MSH5, leading to enhance their binding to recombination sites, and acts as a limiting factor for crossover designation and/or reinforcement.RNF212 protein is being studied for its involvement in recombination rate qtl 1 disorder. Little is currently known about this protein interactions with other proteins.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: IHC, IHC-P, WB
Species: Ca, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Bv, Hu, Mu, Rt(-)
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ELISA, WB
Species: Hu
Applications: IHC
Publications for RNF212 Antibody (NBP2-49259) (0)
There are no publications for RNF212 Antibody (NBP2-49259).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for RNF212 Antibody (NBP2-49259) (0)
There are no reviews for RNF212 Antibody (NBP2-49259).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
FAQs for RNF212 Antibody (NBP2-49259) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional RNF212 Products
Blogs on RNF212