![Western Blot: RNF182 Antibody [NBP1-82707] - Analysis in control (vector only transfected HEK293T lysate) and RNF182 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).](http://images.novusbio.com/fullsize/RNF182-Antibody-Western-Blot-NBP1-82707-img0006.jpg "Western Blot: RNF182 Antibody [NBP1-82707] - Analysis in control (vector only transfected HEK293T lysate) and RNF182 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, IHC, KD |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Description | Novus Biologicals Rabbit RNF182 Antibody - BSA Free (NBP1-82707) is a polyclonal antibody validated for use in IHC and WB. Anti-RNF182 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: VLECCHRVCAKCLYKIIDFGDSPQGVIVCPFCRFETCLPDDEVSSLPDDNNILVNLTCGGKGKKCLPENPTELLLTPKRLASLVSPSHTSSNCLVITIMEVQRESSPSLSSTPVVEFYRPASFDSVTTVSHNWTVWNCTSLL |
| Predicted Species | Rat (99%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | RNF182 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended.. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
| Publication using NBP1-82707 | Applications | Species |
|---|---|---|
| Jiang H, Lin X, Liang W et al. Friedelin Alleviates the Pathogenesis of Collagenase-Induced Tendinopathy in Mice by Promoting the Selective Autophagic Degradation of p65 Nutrients 2022-04-18 [PMID: 35458235] (KD, WB, Mouse) | KD, WB | Mouse |
Secondary Antibodies |
Isotype Controls |
Research Areas for RNF182 Antibody (NBP1-82707)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | RNF182 |
![Immunohistochemistry-Paraffin: RNF182 Antibody [NBP1-82707] - Staining of human lymph node shows strong cytoplasmic positivity in lymphoid cells outside reaction centra.](http://images.novusbio.com/fullsize/RNF182-Antibody-Immunohistochemistry-Paraffin-NBP1-82707-img0002.jpg "Immunohistochemistry-Paraffin: RNF182 Antibody [NBP1-82707] - Staining of human lymph node shows strong cytoplasmic positivity in lymphoid cells outside reaction centra.")
![Immunohistochemistry-Paraffin: RNF182 Antibody [NBP1-82707] -Staining of human spleen shows moderate membranous positivity in cells in white pulp.](http://images.novusbio.com/fullsize/antibody/nbp1-82707_rabbit-polyclonal-rnf182-antibody-immunohistochemistry-paraffin-612025132315..png "Immunohistochemistry-Paraffin: RNF182 Antibody [NBP1-82707] -Staining of human spleen shows moderate membranous positivity in cells in white pulp.")
![Immunohistochemistry-Paraffin: RNF182 Antibody [NBP1-82707] - Staining of human kidney shows moderate membranous positivity in cells in glomeruli.](http://images.novusbio.com/fullsize/antibody/nbp1-82707_rabbit-polyclonal-rnf182-antibody-immunohistochemistry-paraffin-612025132418..png "Immunohistochemistry-Paraffin: RNF182 Antibody [NBP1-82707] - Staining of human kidney shows moderate membranous positivity in cells in glomeruli.")
![Immunohistochemistry-Paraffin: RNF182 Antibody [NBP1-82707] - Staining of human liver shows no positivity in hepatocytes as expected.](http://images.novusbio.com/fullsize/antibody/nbp1-82707_rabbit-polyclonal-rnf182-antibody-immunohistochemistry-paraffin-612025132530..png "Immunohistochemistry-Paraffin: RNF182 Antibody [NBP1-82707] - Staining of human liver shows no positivity in hepatocytes as expected.")
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")