RHAG Antibody

Images

 
Western Blot: RHAG Antibody [NBP1-69665] - This Anti-RHAG antibody was used in Western Blot of HepG2 tissue lysate at a concentration of 1.25ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

RHAG Antibody Summary

Immunogen
Synthetic peptides corresponding to RHAG(Rh-associated glycoprotein) The peptide sequence was selected from the middle region of RHAG. Peptide sequence FGAVLGKTSPTQMLIMTILEIVFFAHNEYLVSEIFKASDIGASMTIHAFG.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RHAG
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against RHAG and was validated on Western blot.
Theoretical MW
45 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Protein A purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for RHAG Antibody

  • ammonium transporter Rh type A
  • CD241 antigen
  • CD241
  • Erythrocyte membrane glycoprotein Rh50
  • Erythrocyte plasma membrane 50 kDa glycoprotein
  • Rh family type A glycoprotein
  • Rh type A glycoprotein
  • RH50
  • Rh50A
  • RH50ARh50
  • Rh50GP
  • Rh-associated glycoprotein
  • Rhesus associated polypeptide, 50-KD
  • Rhesus blood group family type A glycoprotein
  • Rhesus blood group-associated ammonia channel
  • Rhesus blood group-associated glycoproteinRH2
  • SLC42A1

Background

The Rh blood group antigens are associated with human erythrocyte membrane proteins of approximately 30 kD, the so-called Rh30 polypeptides. Heterogeneously glycosylated membrane proteins of 50 and 45 kD, the Rh50 glycoproteins, are coprecipitated with the Rh30 polypeptides on immunoprecipitation with anti-Rh-specific mono- and polyclonal antibodies. The Rh antigens appear to exist as a multisubunit complex of CD47, LW, glycophorin B, and play a critical role in the Rh50 glycoprotein.The Rh blood group antigens (MIM 111700) are associated with human erythrocyte membrane proteins of approximately 30 kD, the so-called Rh30 polypeptides. Heterogeneously glycosylated membrane proteins of 50 and 45 kD, the Rh50 glycoproteins, are coprecipitated with the Rh30 polypeptides on immunoprecipitation with anti-Rh-specific mono- and polyclonal antibodies. The Rh antigens appear to exist as a multisubunit complex of CD47 (MIM 601028), LW (MIM 111250), glycophorin B (MIM 111740), and play a critical role in the Rh50 glycoprotein.[supplied by OMIM].

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-07087
Species: Hu
NBP1-69668
Species: Hu
Applications: WB
NBP2-31106
Species: Hu
Applications: WB, Flow, IHC, IHC-P, IP, CyTOF-ready, Flow-CS
NBP2-59022
Species: Hu
Applications: WB, ICC/IF
NB100-56598
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr, IHC-P
H00051458-M06
Species: Hu, Rt
Applications: WB, ELISA, IHC, IHC-P
AF7179
Species: Hu
Applications: WB, Simple Western, Flow, CyTOF-ready
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-56708
Species: Hu, Mu, Rt, Po, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready
NBP1-89783
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00080303-M05
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB100-1477
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NB120-11012
Species: Hu, Bv(-), Ca(-), Eq(-), Gp(-), Mu(-), Po(-)
Applications: WB, ELISA, ICC/IF, IP
NBP2-47476
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-57578
Species: Hu
Applications: WB
NBP1-80849
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-87349
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-82455
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88036
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-69665
Species: Hu
Applications: WB

Publications for RHAG Antibody (NBP1-69665) (0)

There are no publications for RHAG Antibody (NBP1-69665).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RHAG Antibody (NBP1-69665) (0)

There are no reviews for RHAG Antibody (NBP1-69665). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RHAG Antibody (NBP1-69665) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RHAG Products

Bioinformatics Tool for RHAG Antibody (NBP1-69665)

Discover related pathways, diseases and genes to RHAG Antibody (NBP1-69665). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RHAG Antibody (NBP1-69665)

Discover more about diseases related to RHAG Antibody (NBP1-69665).
 

Pathways for RHAG Antibody (NBP1-69665)

View related products by pathway.

PTMs for RHAG Antibody (NBP1-69665)

Learn more about PTMs related to RHAG Antibody (NBP1-69665).

Blogs on RHAG

There are no specific blogs for RHAG, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RHAG Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RHAG
Uniprot