RGS7BP Antibody

Images

 
Western Blot: RGS7BP Antibody [NBP2-14504] - Analysis in human cell line NTERA-2.
Immunohistochemistry-Paraffin: RGS7BP Antibody [NBP2-14504] - Staining of human hippocampus shows moderate cytoplasmic and nucleolar positivity in neuronal cells.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

RGS7BP Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: AEMHKTRTKGCEMARQAHQKLAAISGPEDGEIHPEICRLYIQLQCCLEMY TTEMLKSICLLGSLQFHRKGKEPGGGTKSLDCKIEESAETPAL
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (94%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RGS7BP
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
RGS7BP Protein (NBP2-14504PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for RGS7BP Antibody

  • R7BP
  • RGS7BP regulator of G-protein signaling 7 binding protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-83390
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00006000-B01P
Species: Hu, Rt
Applications: WB, Flow
NBP1-58919
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-46123
Species: Hu
Applications: WB, IHC, IHC-P, IF
NB100-56659
Species: Hu, Mu, Rt
Applications: WB
NBP2-48946
Species: Hu
Applications: IHC
NBP1-89489
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NLS418
Species: Hu
Applications: IHC-P
NB100-56658
Species: Hu, Mu, Rt
Applications: WB
H00442206-R02
Species: Hu
H00441931-R02
Species: Hu
MAB194
Species: Hu, Mu
Applications: WB, Flow, CyTOF-ready, ICC
MAB8458
Species: Hu
Applications: Flow, CyTOF-ready, ICC
NBP1-02658
Species: Hu
Applications: ICC/IF (-), WB, IHC, IHC-P
NBP1-84903
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-14504
Species: Hu, Mu
Applications: WB, IHC, IHC-P

Publications for RGS7BP Antibody (NBP2-14504) (0)

There are no publications for RGS7BP Antibody (NBP2-14504).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RGS7BP Antibody (NBP2-14504) (0)

There are no reviews for RGS7BP Antibody (NBP2-14504). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RGS7BP Antibody (NBP2-14504) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RGS7BP Products

RGS7BP NBP2-14504

Bioinformatics Tool for RGS7BP Antibody (NBP2-14504)

Discover related pathways, diseases and genes to RGS7BP Antibody (NBP2-14504). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RGS7BP Antibody (NBP2-14504)

Discover more about diseases related to RGS7BP Antibody (NBP2-14504).
 

Pathways for RGS7BP Antibody (NBP2-14504)

View related products by pathway.

PTMs for RGS7BP Antibody (NBP2-14504)

Learn more about PTMs related to RGS7BP Antibody (NBP2-14504).

Blogs on RGS7BP

There are no specific blogs for RGS7BP, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RGS7BP Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RGS7BP