Recombinant Human RGS20 Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human RGS20 Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 78-176 of Human RGS20

Source: Wheat Germ

Amino Acid Sequence: NQEDQRPTIASHELRADLPTWEESPAPTLEEVNAWAQSFDKLMVTPAGRNAFREFLRTEFSEENMLFWMACEELKKEANKNIIEEKARIIYEDYISILS

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
RGS20
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.
Theoretical MW
36.63 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human RGS20 Protein

  • G(z)GAP
  • Gz-GAP
  • Gz-selective GTPase-activating protein
  • regulator of G-protein signaling 20
  • Regulator of G-protein signaling Z1
  • regulator of G-protein signalling 20
  • Regulator of Gz-selective protein signaling 1
  • RGSZ1g(z)GAP
  • ZGAP1gz-GAP

Background

RGS20 - regulator of G-protein signalling 20

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-24516
Species: Hu, Mu
Applications: WB, IHC-P
NBP1-33694
Species: Hu
Applications: WB, ICC/IF
NBP1-89489
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88111
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-49461
Species: Hu, Mu, Rt, Bv
Applications: WB, ICC/IF, IHC, IHC-Fr, In vivo
NB100-1353
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP1-83257
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-86020
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-32284
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB120-14264
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
H00006000-B01P
Species: Hu, Rt
Applications: WB, Flow
NB500-487
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P, IP
NB100-1029
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP1-82558
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84168
Species: Hu
Applications: IHC, IHC-P
NBP1-00178
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, PEP-ELISA

Publications for RGS20 Partial Recombinant Protein (H00008601-Q01) (0)

There are no publications for RGS20 Partial Recombinant Protein (H00008601-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RGS20 Partial Recombinant Protein (H00008601-Q01) (0)

There are no reviews for RGS20 Partial Recombinant Protein (H00008601-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RGS20 Partial Recombinant Protein (H00008601-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional RGS20 Products

Bioinformatics Tool for RGS20 Partial Recombinant Protein (H00008601-Q01)

Discover related pathways, diseases and genes to RGS20 Partial Recombinant Protein (H00008601-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RGS20 Partial Recombinant Protein (H00008601-Q01)

Discover more about diseases related to RGS20 Partial Recombinant Protein (H00008601-Q01).
 

Pathways for RGS20 Partial Recombinant Protein (H00008601-Q01)

View related products by pathway.

PTMs for RGS20 Partial Recombinant Protein (H00008601-Q01)

Learn more about PTMs related to RGS20 Partial Recombinant Protein (H00008601-Q01).
 

Research Areas for RGS20 Partial Recombinant Protein (H00008601-Q01)

Find related products by research area.

Blogs on RGS20

There are no specific blogs for RGS20, but you can read our latest blog posts.

Customers Who Bought This Also Bought

RGS20 Antibody
NBP2-62667
DIO2 Antibody
NBP1-00178

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human RGS20 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol RGS20